Loading...

An in vitro study of the expression, purification and intramolecular interactions of Hepatoma Up Regulated Protein (HURP)

by Eva Ka (Author)

Bachelor Thesis 2011 100 Pages

Biology - Micro- and Molecular Biology

Excerpt

ΠεριεχόμενĮ

1. ΕισĮγωγή

2. Υλικά κĮι Μέθοδοι
2.1. Υλικά
2.1.1. ΒĮκτηριĮκά στελέχη του βĮκτηρίου Escherichia Coli
2.1.2. Φορείς Κλωνοποίησης
2.1.3. Υλικά κĮι μηχĮνήμĮτĮ που πĮρĮλĮμβάνοντĮι Įπο τις ετĮιρίες πĮρĮσκευής τους
2.1.4. Stock ΔιĮλύμĮτĮ
2.1.4.1.Αντιβιοτικά
2.1.4.2. ΟξέĮ, βάσεις κĮι άλĮτĮ
2.1.4.3.ΔιάλυμĮ γιĮ ηλεκτροφόρηση σε πήκτωμĮ ĮγĮρόζης
2.1.4.4.ΔιάλυμĮτĮ γιĮ ηλεκτροφόρηση σε πηκτή πολυĮκρυλĮμίδης (SDS-PAGE)
2.1.4.5. ΔιĮλύμĮτĮ γιĮ ĮνοσοĮποτύπωση κĮτĮ Western
2.1.4.6.ΆλλĮ Stock διĮλύμĮτĮ
2.2. Μέθοδοι
2.2.1. Απομόνωση πλĮσμιδιĮκου DNA σε μικρή ή μεσĮίĮ κλίμĮκĮ με τη χρήση τυποποιημένης συσκευĮσίĮς
2.2.2. ΔιĮτήρηση στελεχών E.coli κĮι πλĮσμιδίων (Glycerol stock ή culture stab)
2.2.3. Ηλεκτροφόρηση DNA σε πήκτωμĮ ĮγĮρόζης
2.2.4. Απομόνωση DNA Įπό πήκτωμĮ ĮγĮρόζης
2.2.5. Αλυσιδωτή ĮντίδρĮση πολυμεράσης (Polymerase Chain Reaction - PCR)
2.2.6. Πέψη DNA με περιοριστικές ενδονουκλεάσες
2.2.7. ΚĮθĮρισμός ενζυμικών πέψεων των γονιδίων προς ĮνĮσυνδυĮσμό κĮι των προϊόντων των Įντιδράσεων PCR
2.2.8. ΚĮτĮκρίμνηση DNA με ĮιθĮνόλη
2.2.9. ΑντίδρĮση σύνδεσης πλĮσμιδιĮκού φορέĮ κλωνοποίησης κĮι μορίου DNA (Ligation)
2.2.10. Δεκτικά κύττĮρĮ
2.2.11. ΜετĮσχημĮτισμός βĮκτηριĮκών κυττάρων..
2.2.12. Απομόνωση πλĮσμιδιĮκού DNA με τη μέθοδο του βρĮσμού σε μικρή κλίμĮκĮ (Boiling mini-preps)
2.2.13. Σάρωση Įποικιών με τη χρήση Αλυσιδωτής ĮντίδρĮσης πολυμεράσης (PCR)
2.2.14. ΔιĮγρĮμμĮτική σύνοψη διĮδικĮσίĮς κλωνοποίησης επιθυμητού γονιδίου σε πλĮσμιδιĮκό φορέĮ
2.2.15. In vitro έκφρĮση πρωτεΐνης γιĮ 1L κĮλλιέργειĮ
2.2.16. Ηλεκτροφόρηση πρωτεϊνών σε πηκτή SDS πολυĮκρυλĮμιδίου (SDS-PAGE)
2.2.17. Απομόνωση ΕκφρĮσμένης Πρωτεϊνης Įπο ΊζημĮ Κυττάρων
2.2.18. ΚĮθĮρισμός ΕκφρĮσμένης Πρωτεϊνης με τη χρήση ριτίνης νικελίου Protino Ni-TED resin
2.2.19. ΚĮθĮρισμός Πρωτείνης με μέθοδο FPLC σε κολώνĮ Νικελίου ( Ni-NTA High-Trap Chelating Column 5ml)
2.2.20. ΔιĮπίδυση (Dialysis)
2.2.21. ΔιĮγρĮμμĮτική σύνοψη διĮδικĮσίĮς Įπομόνωσης εκφρĮσμένων (σε μη ĮποδιĮτĮχτικές συνθήκες) κĮθĮρών πρωτεϊνών
2.2.22. ΗλεκτρομετĮφορά πρωτεϊνών σε μεμβράνη νιτροκυττĮρίνης κĮι ΑνοσοĮποτύπωση (Western blotting)
2.2.23. ΑνοσοĮποτύπωση κĮτĮ Western (Western blotting)
2.2.24. ΔιĮφορική Φθορισμομετρική Σάρωση (DSF- Differential Scanning Fluorimetry)
2.2.25. Υγρή ΧρωμĮτογρĮφίĮ ΜοριĮκής Διήθησης (Size exclution Chromatography- SEC)
2.2.26. Υγρή ΧρωμĮτογρĮφίĮ ΙοντοĮντĮλλĮγής (Ion Exchange Chromatography)
2.2.27. ΚĮθίζιση πρωτεΐνών μέσω ĮνĮσυνδυĮσμένης πρωτεΐνης (Pull Down)

3. ΑποτελέσμĮτĮ
3.1. Εύρεση συνθηκών in vitro έκφρĮσης, Įπομόνωσης κĮι στĮθερότητĮς των πρωτεϊνικών τμημάτων 6XHis- Ν2 , 6ΧΗis-C σε βĮκτηριĮκό στέλεχος E.Coli BL21 Star DE3 pRARE2
3.1.1. Άμινο-τελικό άκρο 6XHis-Ν2
3.1.2. ΚĮρβοξυτελικό-τελικό άκρο 6ΧHis-C
3.2. ΔημιουργίĮ κĮι Įπομόνωση συμπλόκου μετĮξύ των τμημάτων 6XHis- Ν2 κĮι 6XHis-C
3.3. Μελέτη πρωτεϊνικών Įλληλεπιδράσεων των τμημάτων Ν2, C κĮι του συμπλόκου Ν& C με μιτωτικά εκχυλίσμĮτĮ HeLa κυττάρων με πείρĮμĮ κĮθίζησης (6XHis-tag pull down)

4. Συζήτηση

5. ΒιβιλιογρĮφίĮ

Περίληψη

Η πρωτεΐνη HURP (Hepatoma Up Regulated Protein) είνĮι ένĮς σχετικά πρόσφĮτĮ χĮρĮκτηρισμένος πĮράγοντĮς του ηπĮτοκυττĮρικού κĮρκίνώμĮτος. ΠρόκειτĮι γιĮ μιĮ πυρηνική MAP (Microtubule Associated Protein) πρωτεΐνη με κεντρικό ρόλο στη μιτωτική διĮίρεση κĮθότι συμμετέχει στο σχημĮτισμό της μιτωτικής Įτράκτου in vivo κĮι in vitro. Δρά στĮθεροποιώντĮς κĮι δεσμοποιώντĮς τους μικροσωληνίσκους ενώ μπορεί νĮ επάγει κĮι τον πολυμερισμό της ελεύθερης τουμπουλίνης σε μιĮ νέĮ διĮμόρφωση. Η έκφρĮση της είνĮι χρονοειδική κĮι ιστοειδική . ΡυθμίζετĮι μέσω των ιμπορτινών Į κĮι β κĮθώς έχει σημĮτοδοτική ĮλληλουχίĮ εισόδου στο πυρήνĮ NLS (Nuclear Localisation Signal ) σε συνδυĮσμό με τη RanGTP που δρά γιĮ την Įπελευθέρωση της Įπο την ιμπορτίνη β. Η HURP στρĮτολογείτĮι Įπο τη RanGTP ωστε νĮ συμμετέχει σε ένĮ πολυπρωτεϊνικό σύμπλοκο που διευθετεί τους μικροσωληνίσκους Įπο δομή ĮστέρĮ (aster -like ) σε δομή ψευδο-Įτράκτου ( spindle- like) σε εκχυλίσμĮτĮ Įυγών Xenopus laevis . ΆλλĮ μέλη του συμπλόκου είνĮι οι MAPs ΤΡΧ2 κĮι Χ215, η κινεσίνη Eg5 κĮι η μιτωτική κινάση σερίνης/θρεονίνης Aurora A.

Επίσης,η HURP φĮίνετĮι νĮ είνĮι υπεύθυνη άμεσĮ ή εμμεσĮ γιĮ τη πĮράβλεψη του σημείου ελέγχου που Įφορά τον ορθό σχημĮτισμό της μιτωτικής Įτράκτου σε εκχυλίσμĮτĮ κυττάρων HeLa.

Το κĮρβόξυ-τελικό κĮι άμινο-τελικό άκρο της HURP Įλληλεπιδρούν ενδομοριĮκά.

ΕνεργοποιείτĮι ότĮν το κĮρβόξυ-τελικό άκρο της φωσφορυλιώνετĮι Įπο τη μιτωτική κινάση Aurora A κĮι έτσι ĮποδεσμεύετĮι το άμινο-τελικό άκρο που φέρει επικράτειĮ ĮλληλεπίδρĮσηες με τους μικροσωληνίσκους.

Η πĮρούσĮ μελέτη εξετάζει τις ενδομοριĮκές Įλληλεπιδράσεις της HURP κĮι το πώς Įυτές συμβάλουν στη λειτουργίĮ της κĮι στη διĮμοριĮκή της ĮλληλεπίδρĮση με άλλες πρωτεΐνες γιĮ το σχημĮτισμό πρωτεϊνικών συμπλόκων. Dzτσι πρĮγμĮτοποιήθηκε in vitro έκφρĮση κĮι κĮθĮρισμός του άμινο-τελικού κĮι κĮρβόξυ-τελικού τμήμĮτος της HURP . Στη συνέχειĮ τĮ δύο τμήμĮτĮ ĮφέθηκĮν νĮ Įλληλεπιδράσουν σε συνθήκες που προσομοιάζουν την φυσιολογική ενδομοριĮκή ĮλληλεπίδρĮση τους . Το σύμπλοκο Įπομονώθηκε με υγρή χρωμĮτογρĮφίĮ διήθησης. DzπειτĮ πρĮγμĮτοποιήθηκĮν πειράμĮτĮ πρωτεϊνικής κĮθίζησης (pull down) μέσω της ĮλληλουχίĮς 6XHis-tag την οποίĮ φέρουν οι ĮνĮσυνδυĮσμένες πρωτεΐνες, σε μιτωτικά κυττĮρικά εκχυλίσμĮτĮ HeLa .

Οι συνθήκες έκφρĮσης κĮι κĮθĮρισμού του Įμινοτελικού κĮι κĮρβοξυτελικού τμήμĮτος της HURP προσδιορίστηκĮν κĮι βελτιώθηκĮν σε ικĮνοποιητικό βĮθμο. Το σύμπλοκο μετĮξύ των δύο τμημάτων σχημĮτίστηκε κĮι Įπομονώθηκε επιτυχώς ενώ Įπο τĮ πειράμĮτĮ πρωτεϊνικής κĮθίζησης δεν ήτĮν δυνĮτή η ĮσφĮλής διεξĮγωγή συμπεράσμĮτος.

1. ΕισĮγωγή

ΚυττĮρικός κύκλος ή κύκλος ζωής του κυττάρου είνĮι το χρονικό διάστημĮ που μεσολĮβεί Įπό τη στιγμή που το κύττĮρο έχει διĮιρεθεί σε δύο θυγĮτρικά έως την στιγμή που κĮι Įυτά θĮ διĮιρεθούν δίνοντĮς το κĮθένĮ τους Įπογόνους του. ΟυσιĮστικά Įποτελεί το χρόνο που μεσολĮβεί μετĮ τη λήξη μιĮς κυττĮρικής διĮίρεσης μέχρι τη λήξη κĮι της επόμενης. Ο κυττĮρικός κύκλος στĮ ευκĮρυωτικά κύττĮρĮ χωρίζετĮι σε δύο φάσεις:

a) την μεσόφĮση που Įντιστοιχεί στο χρόνο που μεσολĮβεί Įπο το τέλος μιĮς κυττĮρικής διĮίρεσης μέχρι την ένĮρξη της επόμενης κĮι
b) την μίτωση ή μιτωτική διĮίρεση (Μ) κĮτĮ την οποίĮ το κύττĮρο διĮιρείτĮι σε δύο θυγĮτρικά .

Η μεσόφĮση κĮτĮλĮμβάνει ποσοστό 90% - 95% της διάρκειĮς ζωής του κύττĮρου. Στη φάση Įυτή διεκπĮιρεώνοντĮι οι ĮπĮρĮίτητες γιĮ τη διĮίρεση διĮδικĮσίες που είνĮι ο διπλĮσιĮσμός του μεγέθους του κυττĮρου κĮι ο διπλĮσιĮσμός του γονιδιώμĮτος.

Η μεσόφĮση υποδιĮιρείτĮι σε επιμέρους φάσεις οι οποίες διĮδέχοντĮι η μιĮ την άλλη κĮι είνĮι με χρονική σειρά οι G1, S κĮι G2. Η κυττĮρική Įύξηση γίνετĮι συνεχώς κĮτĮ τη διάρκειĮ όλων των πĮρĮπάνω φάσεων ενώ ο διπλĮσιĮσμός του γονιδιώμĮτος περιορίζετĮι στη φάση S. Η χρονική διάρκειĮ κάθε φάσης ποκίλει ĮνάμεσĮ στĮ είδη των οργĮνισμών , σε άτομĮ του ίδιου είδους κĮι ĮνάμεσĮ στους διάφορους κυττĮρικούς τύπους ενός οργĮνισμού. Η διάρκειĮ της G1 φάσης μάλιστĮ επηρεάζετĮι κĮι Įπο φυσιολογικούς κĮι περιβĮλλοντικούς πĮράγοντες. ΑνεξάρτητĮ όμως Įπο την Įκριβή χρονική διάρκειĮ της G1 , σε κάθε περίπτωση είνĮι η φάση που διĮρκεί περισσότερο Įπο κάθε άλλη .

H φάση G1 (gap 1) χĮρĮκτηρίζετĮι Įπο υψηλή μετĮβολική δρĮστηριότητĮ κĮι κĮτĮ συνέπειĮ λĮμβάνει χώρĮ η εντĮτική σύνθεση πρωτεϊνών κĮι RNA. ΙδιĮίτερη έμφĮση δίνετĮι στην έκφρĮση ενζύμων ĮπĮρĮίτητων γιĮ την πρόοδο του κυττĮρικού κύκλου στη φάση S που Įκολουθεί.

Στη φάση S (synthesis) πρĮγμĮτοποιείτĮι η ĮντιγρĮφή του γονιδιώμĮτος κĮι ο διπλĮσιĮσμός των χρωμοσωμάτων. Οι μετĮβολικοί ρυθμοί του κυττάρου μειώνοντĮι σημĮντικά κĮι επιμένει μόνο η έκφρĮση των ιστονών οι οποίες είνĮι ĮπĮρĮίτητες γιĮ τη σύνθεση της νέĮς χρωμĮτίνης.

Η μεσόφĮση ολοκληρώνετĮι με τη φάση G2 (gap2) κĮτĮ την οποίĮ επιτελείτε έλεγχος κĮι επιδιόρθωση της δομής του νεοσυντιθέμενου DNA κĮι γίνοντĮι όλες οι ĮπĮρĮίτητες προετοιμĮσίες γιĮ την εισĮγωγή στη μίτωση.

Ακόμη, θĮ πρέπει νĮ ĮνĮφερθεί η περίπτωση των τελικώς διĮφοροποιημένων κυττάρων (μετĮ-μιτωτικά), τĮ οποίĮ δε διĮιρούντĮι κĮι βρίσκοντĮι στη φάση G0. Αυτά τĮ κύττĮρĮ μπορεί νĮ μην διĮιρεθούν ποτέ ξĮνά ή νĮ διĮιρούντĮι περιστĮσιĮκά. Στη φάση G0 μπορεί νĮ εισέλθουν κĮι μη διĮφοροποιημένĮ κύττĮρĮ λόγω τροφικών συνθηκών στο περιβάλλον ή μηνυμάτων που λĮμβάνουν τĮ κύττĮρĮ. Η διάρκειĮ Įυτού του στĮδίου ποικίλει κĮι μπορεί νĮ διĮρκέσει ημέρες, μήνες ή κĮι χρόνιĮ.[[2]]

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 1.1 ΟκυττĮρικός κύκλος κĮι τĮ κυριότερĮ σημείĮ ελέγχου του. (Adapted from Alberts et al. Molecular Biology of the Cell. Garland Publishing, 2008.)

Τη φάση G2 διĮδέχετĮι η μίτωση που υποδιĮιρείτĮι σε έξι υποφάσεις:

πρόφĮση, προμετάφĮση, μετάφĮση, ĮνάφĮση Α κĮι Β κĮι τελόφĮση. Η μίτωση χωρίζετĮι επίσης σε δύο περιόδους, Įυτή της διĮίρεσης κĮι Įυτή της κυττĮροκίνησης. Αρχικά, κĮτά την πρόφĮση (prophase) συσπειρώνοντĮι τĮ χρωμοσώμĮτĮ κĮι ξεκινά η συγκρότηση της μιτωτικής Įτράκτου, ενώ μειώνετĮι ο μετĮβολικός ρυθμός. Στη προμετάφĮση (prometaphase), ĮποδομείτĮι ο πυρηνικός φάκελος κĮι ολοκληρώνετĮι ο σχημĮτισμός της μιτωτικής Įτράκτου [[2]]. Η μιτωτική άτρĮκτος ĮποτελείτĮι Įπο δύο πόλους κĮι είνĮι υπεύθυνη γιĮ το διĮχωρισμό των διπλĮσιĮσμένων χρωμοσωμάτων κĮι τη κĮτĮνομή τους στĮ θυγĮτρικά κύττĮρĮ. Οι δύο πόλοι της μιτωτικής Įτράκτου σχημĮτίζοντĮι με το διπλĮσιĮσμό του κεντροσωμĮτίου κĮι τĮ δύο κεντροσωμάτιĮ Įποτελούν τĮ κέντρĮ οργάνωσης των μικροσωληνίσκων (MTOCs), μĮζί με τους κινητοχώρους των χρωμοσωμάτων.

ΤĮ κεντροσωμάτιĮ εντοπίζοντĮι στους πόλους της Įτράκτου κĮι ĮποτελούντĮι Įπό δύο κεντριόλιĮ. Εμπυρυνώνουν τους μικροσωληνίσκους οι οποίοι εκτείνοντĮι προς τĮ χρωμοσώμĮτĮ κĮι προσδένοντĮι στους κινητοχώρους τους. [[1]] Στη συνέχειĮ, κĮτά τη διάρκειĮ της μετάφĮσης (metaphase) τĮ χρωμοσώμĮτĮ, όντĮς συνδεδεμένĮ μέσω των κινητοχώρων τους με τους μικροσωληνίσκους, πĮρĮτάσσοντĮι στον ισημερινό της μιτωτικής Įτράκτου. Ακολουθεί το στάδιο της ĮνάφĮσης (anaphase) που διĮκρίνετĮι στην ĮνάφĮση Α, όπου διĮχωρίζοντĮι οι Įδελφές χρωμĮτίδες, κĮι στην ĮνάφĮση Β, όπου ĮπομĮκρύνοντĮι συγχρόνως κĮι οι πόλοι της Įτράκτου. ΜετέπειτĮ, στην τελόφĮση (telophase) τĮ χρωμοσώμĮτĮ ĮποσυσπειρώνοντĮι, εμφĮνίζοντĮι δύο πυρηνίσκοι κĮθένĮς Įπο τους οποίους περιβάλει μιĮ πĮνομοιότυπη σειρά χρωμοσωμάτων. Οι πυρηνικές μεμβράνες επĮνĮσχημĮτίζοντĮι γύρω Įπο τους πυρηνίσκους κĮι ο ρυθμός μετĮβολισμού ĮυξάνετĮι. Στο στάδιο της τελόφĮσης η μιτωτική άτρĮκτος ĮποσυνĮρμολογείτĮι. Τέλος, μετά την ολοκλήρωση κĮι της τελόφĮσης , λĮμβάνει χώρĮ η κυττĮροδιĮίρεση ώστε νĮ δημιουργηθούν τĮ δύο θυγĮτρικά κύττĮρĮ μέσω του συστĮλτικού δĮκτυλίου.[[1]],[[2]]

Abbildung in dieser Leseprobe nicht enthalten

ΕικόνĮ 1.2 Οι φάσεις της Μίτωσης (Μ). (Adapted from Alberts et al. Molecular Biology of the Cell. Garland Publishing, 2008.)

Η ομĮλή διĮδοχή των φάσεων κĮτά τη διάρκειĮ του κυττĮρικού κύκλου, η ĮκερĮιότητĮ του DNA κĮι η σωστη συγκρότηση της Įτράκτου, διĮδρĮμĮτίζουν κρίσιμο ρόλο στην ορθή διĮίρεση των κυττάρων. Η ομĮλή διεξĮγωγή τους διĮσφĮλίζει πως τĮ δύο θυγĮτρικά κύττĮρĮ έχουν το σωστό Įριθμό χρωμοσωμάτων κĮι η ĮλληλουχίĮ του γονιδιώμĮτος είνĮι σωστή. Στην περίπτωση που υπάρχει κάποιĮ βλάβη, μπορεί νĮ δημιουργηθούν κύττĮρĮ με ĮνευπλοειδίĮ ή μετĮλλάξεις στο γονιδίωμά τους. Η ρύθμιση των πĮρĮπάνω διĮδικĮσιών εξĮσφĮλίζετĮι Įπο πολλĮπλά σημείĮ ελέγχου (checkpoints) κĮθ’ όλη τη διάρκειĮ του κύκλου.

ΤĮ κυριότερĮ σημείĮ ελέγχου που Įξίζει νĮ ĮνĮφερθούν είνĮι (εικόνĮ 1.1):

1. Το σημείο ελέγχου της φάσης G1 (γνωστό κĮι ως σημείο περιορισμού). Στο σημείο Įυτό ελέγχετĮι Įν το μικροπεριβάλλον του κυττάρου είνĮι ευνοϊκό γιĮ διĮίρεση κĮι Įν το DNA έχει βλάβες. ΟτĮν ξεπερĮστεί το σημείο περιορισμού, το κύττĮρο δεσμεύετĮι γιĮ την ĮντιφρĮφή του γονιδιώμĮτος του (φάση S)
2. Το σημείο μετάβĮσης Įπό τη G2 στην Μ φάση. Στο σημείο Įυτό ελέγχετĮι Įν έχει ολοκληρωθεί επιτυχώς η ĮντιγρĮφή του DNA κĮι Įν Įυτό έχει βλάβες. Ο επιτυχής έλεγχος στο σημείο Įυτό πυροδοτεί την ένĮρξη της μίτωσης.
3. Το σημείο ελέγχου υπεύθυνο γιĮ τη λειτουργικότητĮ της μιτωτικής Įτράκτου. [[2]]

Σε όλες τις διĮδικĮσίες του κυττĮρικού κύκλου πĮίρνουν μέρος πολλές πρωτεΐνες με διĮφορετικές λειτουργείες .

ΜίĮ Įπό τις πιο σημĮντικές πρωτεϊνες είνĮι η μονομερής πυρηνική G πρωτεΐνη Ran. ΕίνĮι ενεργή ότĮν έχει προσδέσει GTP κĮι σε Įυτή τη μορφή βρίσκετĮι στον πυρήνĮ, ενώ στην Įνενεργή της μορφή που υπάρχει κυρίως στο κυττĮρόπλĮσμĮ, είνĮι συνδεδεμένη με GDP. Η Ran ελέγχει την κĮτεύθυνση της πρωτεϊνικής μετĮφοράς διĮμέσου του πυρηνικού φĮκέλου κĮτά τη μεσόφĮση κĮι κĮτά τη μίτωση, όπου ο πυρηνικός φάκελος έχει πλέον κĮτĮστρĮφεί. Δρά με την υδρόλυση του GTP προς GDP κĮι η ενέργειĮ που εκλύετĮι κĮτĮνĮλώνετĮι γιĮ την Įπελευθέρωση πρωτεϊνών Įπό τους στόχους της Ran, τις ιμπορτίνες Į κĮι β. Οι ιμπορτίνες Į κĮι β είνĮι πρωτεΐνες-κλειδιά γιĮ τη μετĮφορά μορίων εντός κĮι εκτός του πυρήνĮ. Στον πυρήνĮ εισέρχοντĮι πρωτεΐνες που φέρουν σημĮτοδοτική ĮλληλουχίĮ εισόδου στο πυρήνĮ (Nuclear Localazation Singnal - NLS ) ενώ εξέρχοντĮι Įυτές με σημĮτοδοτική ĮλληλουχίĮ εξόδου Įπο το πυρήνĮ ( Nuclear Export Signal - NES). Οι ιμπορτίνες Į κĮι β σχημĮτίζουν ετεροδιμερή. Η ιμπορτίνη Į ĮνĮγνωρίζει κĮι προσδένετĮι στην ĮλληλουχίĮ NLS ή NES ενώ η ιμπορτίνη β φέρει τη πρωτεΪνη-φορτίο.

Η Ran βρίσκετĮι ενεργή κοντά στη χρωμĮτίνη, όπου ο εντοπισμός του πĮράγοντĮ ĮντĮλλĮγής νουκλεοτιδίου γουĮνίνης RCC1 είνĮι εμπλουτισμένο. Ο RCC1 συσχετίζετĮι με τĮ χρωμοσώμĮτĮ κĮι ενεργοποιεί τη Ran «φορτώνοντĮς» τη με GTP. ΓιĮ την Įπενεργοποίηση της Ran ευθύνετĮι η πρωτεΐνη Ran-GAP, η οποίĮ υδρολύει το GTP. Η Ran-GAP ρυθμίζετĮι μέσω των πĮρĮγόντων RanBP1/2. [[7],8,9,4]

RanGTP → RanGDP

Τελικά, δημιουργείτĮι διĮβάθμιση της συγκέντρωσης της Ran, με τĮ υψηλότερĮ επίπεδĮ νĮ βρίσκοντĮι κοντά στĮ χρωμοσώμĮτĮ κĮι τĮ χĮμηλότερĮ στους πόλους της Įτράκτου. Η διĮβĮθμισμένη συγκέντρωση της Ran-GTP

Abbildung in dieser Leseprobe nicht enthalten

B. Lewin, GENES VIII (2004), Parson Education. 8 ΕικονĮ 1.3 Εντοπισμός της Ran κĮτĮ τη μίτωση

είνĮι Įπό τĮ σημĮντικότερĮ χĮρĮκτηριστικά της διότι με Įυτό τον τρόπο ελέγχετĮι η ενεργότητĮ άλλων πρωτεϊνών.

Dzτσι, η Ran-GTP Įπελευθερώνει τĮ πρωτεϊνικά φορτίĮ των ιμπορτινών Į/β κοντά στĮ χρωμοσώμĮτĮ κĮι επάγει τη συνĮρμολόγηση των μικροσωληνίσκων κĮι τη διπολική οργάνωση . [[1],2,3,4,5,6]

Σε εκχυλίσμĮτĮ Įυγών Xenopus Laevis έχει βρεθεί οτι η Ran-GTP επάγει τη συνĮρμολόγηση των μικροσωληνίσκων σε δομή ĮστέρĮ (aster-like ) ή ψευδοĮτράκτου (spindle-like) Įκόμη κĮι ĮπουσίĮ χρωμοσωμάτων κĮι κεντροσωμάτων. [[6]] Το σύμπλοκο που ĮπĮιτείτĮι γιĮ τη μετĮτροπή Įπο δομή μορφής ĮστέρĮ σε δομή μορφής ψευδοĮτράκτου περιλĮμβάνει δύο πρωτεΐνες σχετιζόμενες με μικροσωληνίσκους (Microtubule-Associated Proteins -MAPs), τις TPX2 κĮι XMAP215. ΑπĮιτείτĮι επίσης η πĮρουσίĮ της κινεσίνης Eg5 , της μιτωτικής κινάσης Aurora A κĮι της πρωτεΐνης HURP (Hepatoma Up-Regulated Protein)

Abbildung in dieser Leseprobe nicht enthalten

Nature Reviews Molecular Cell Biology 9, 464-477 (June 2008) | doi:10.1038/nrm2410

ΕικόνĮ 1.4 ΣχημĮτική Įπεικόνηση των συμπλόκων που συμμετέχουν στο σχημĮτισμό της μιτωτικής Įτράκτου κĮτά τη μίτωση.

Η Ran, επιδρώντĮς στις ιμπορτίνες Į/β Įπελευθερώνει ποικίλλου τύπου πρωτεΐνες : κινητήριες (κινεσίνες κĮι δυνεΐνες) κĮι μη κινητήριες, πρωτεΐνες σχετιζόμενες με μικροσωληνίσκους (MAPs, Microtubules Associated Proteins) κĮι άλλους πĮράγοντες. ΑνάμεσĮ σε Įυτές τις πρωτεϊνες είνĮι κĮι οι πυρηνικές πρωτεΐνες NuMa, TPX2 κĮι HURP που δρούν ως πĮράγοντες συνĮρμολόγησης της Įτράκτου.

Abbildung in dieser Leseprobe nicht enthalten

Εικονα 1.5 Η HURP στοχεύει και σταɽεροποιεί τα k-fibers. Απουσία τηʎ τ χρωμοσώματα δεν προσδένονται στουʎ κινητοχώρουʎ αν και το κύτταρο περνɳ στην ανɳφαση

Wilde A., J Cell Biol. 2006 Jun 19;173(6):829-31.

Η πυρηνική πρωτεΐνη HURP (Hepatoma Up Regulated Protein), ονομάστηκε έτσι κĮθώς υπερεκφράζετĮι στο το ηπĮτοκυττĮρικό κĮρκίνωμĮ. ΕίνĮι μιĮ MAP πρωτεΐνη, η οποίĮ ĮπελευθερώνετĮι Įπό την ιμπορτίνη β μέσω της Ran-GTP κĮτά τη μίτωση. Dzτσι, ο εντοπισμός της εξĮρτάτĮι άμεσĮ Įπό τη διĮβάθμιση συγκέντρωσης της Ran-GTP κĮι κĮτ’ επέκτĮση είνĮι ενεργή κοντά στĮ χρωμοσώμĮτĮ. [ [7],8]

Ο εντοπισμός της ποικίλει κĮι εξĮρτάτĮι Įπο τη φάση του κυττĮρικού κύκλου που εξετάζετĮι. ΚĮτĮ την πρόφĮση βρίσκετĮι στους πόλους της Įτράκτου, στĮ σημείĮ εμπυρήνωσης των μικροσωληνίσκων. ΚĮτά την μεσόφĮση, πĮρĮτηρούντĮι τĮ υψηλότερĮ επίπεδĮ έκφρĮσης κĮι ο εντοπισμός της HURP μετĮτοπίζετĮι στους μικροσωληνίσκους των κινητοχώρων (k-fibers) . Στην τελόφĮση η έκφρĮση εκλείπει.

Η συγκέντρωση της σε κάθε φάση του κυττĮρικού κύκλου ρυθμίζετĮι σε μετĮ-μετĮφρĮστικό επίπεδο με φωσφορυλίωση σε πολλĮπλά σημείĮ Įπό το σύμπλοκο Cdk1-Cyclin B. Οι φωσφορυλιώσεις κĮθιστούν τη HURP στόχο της Ε3 λιγάσης της ουβικιτίνης SCFFbx7, που προσδένετĮι μέσω μιĮς περιοχής στο κĮρβόξυ-τελικό άκρο , πλούσιĮς σε προλίνη. [[21],22]

Η ουβικιτινιωμένη HURP ĮποικοδομείτĮι Įπό το πρωτεάσωμĮ 26S. [[9]]

Επιπλέον, η έκφρĮση της HURP φĮίνετĮι νĮ είνĮι ιστοειδική κĮι χρονοειδική . ΤĮ υψηλότερĮ επίπεδĮ ĮνιχνεύοντĮι σε εμβρυικό ήπĮρ, ĮκολουθούντĮι Įπό το μυελό των οστών, τους όρχεις, το πĮχύ έντερο κĮι τον πλĮκούντĮ. [[10]]

Το γονίδιο γιĮ την Įνθρώπινη hHURP εδράζετĮι στο χρωμόσωμĮ 14q22-23, ĮποτελείτĮι Įπό 19 εξόνιĮ που κωδικοποιούν γιĮ 846 ĮμινοξέĮ (εικόνĮ1.6) . Dzχουν τĮυτοποιηθεί δύο ισομορφές της HURP με διĮφορετικό μοριĮκό βάρος, η μίĮ Įντιστοιχεί στĮ 130kDa κĮι η άλλη στĮ 250-300kDa κĮι πιστεύετĮι πως Įντιπροσωπεύει ολιγομερές ενωμένο με ομοιοπολικούς δεσμούς της πρώτης, το οποίο είνĮι πολύ πιο στĮθερό.

Από δομική σκοπιά , στην ĮλληλουχίĮ της HURP υπάρχει σήμĮτοδοτική ĮλληλουχίĮ εισόδου στο πυρήνĮ (NLS) κĮι το Įντίστοιχο σήμĮ εξόδου Įπο το πυρήνĮ (NES, Nuclear Export Signal) τĮ όποιĮ είνĮι πλούσιĮ σε λευκίνη. Dzχεί επίσης δύο D-κουτιά (κουτιά κĮτĮστροφής- D-box), ένĮ ΚΕΝ-κουτί (KEN- box), ένĮ πιθĮνό μοτίβο σπειροειδούς σπειράμĮτος. Επίσης, έχει μίĮ επικράτειĮ GH1 στην περιοχή 432-537 ĮμινοξέĮ, η οποίĮ εμφĮνίζει σημĮντική ομολογίĮ με την οικογένειĮ πρωτεϊνών GKAP που θεωρείτĮι ότι πĮίζουν το ρόλο πρωτεϊνών-ικριωμάτων σε διĮύλους ιόντων, ενώ στο άμινο-τελικό της άκρο εμφĮνίζετĮι Įσθενής ομολογίĮ με μίĮ επικράτειĮ της πρωτεΐνης E-MAP- 115 στην περιοχή 66-220 ĮμινοξέĮ, που έχει δειχτεί ότι προσδένετĮι στους μικροσωληνίσκους. [10, 11]

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 1.6 Οργάνωση του Įνθρώπινου γονιδίου της HURP το οποίο εδράζετĮι στο 14q22-23 χρωμόσωμĮ κĮι ĮποτελείτĮι Įπο 19 εξώνιĮ.

Tsou et al., Oncogene (2003) 22, 298-307. doi:10.1038/sj.onc.1206129

ΕικόνĮ 1.7.Η πρωτεϊνική ĮλληλουχίĮ της hHURP σε one letter code, όπου υποδεικνύοντĮι τĮ μοτίβĮ.

ǵπως έχει ĮνĮφερθεί Η HURP Įποτελεί μέρος του συμπλόκου που είνĮι υπεύθυνο γιĮ την Įνάπτυξη, οργάνωση κĮι στĮθερότητĮ των μικροσωληνίσκων που βρίσκοντĮι σε σύνδεση με τους κινητοχώρους (K- fiber). [[8]] Το σύμπλοκο Įυτό ĮπĮιτείτĮι γιĮ την μετĮτροπή των μικροσωληνίσκων Įπό δομή ĮστέρĮ σε δομή Įτράκτου, διĮδικĮσίĮ την οποίĮ επάγει κĮι η Ran-GTP σε εκχυλίσμĮτĮ Įυγών βĮτράχου Xenopus.

ΘυμίζετĮι οτι ĮποτελείτĮι Įπό τις TPX2 κĮι XMAP215, δύο MAPs, την κινεσίνηEg5, τη μιτωτική κινάση σερίνης-θρεονίνης Aurora A κĮι τη HURP.

Abbildung in dieser Leseprobe nicht enthalten

ΕικόνĮ1.8 Ρόλος της HURP στο

σύμπλοκο συγκρότησης της μιτωτικής Įτράκτου. AπελευθερώνετĮι Įπο τις ιμπορτίνες Į/β μέσω της RanGTP, Įλληλεπιδρά με τις Eg5, TPX2, Aurora A κĮι XMAP215 προωθώντĮς το σχημĮτισμό k-fibers κĮι τη

στĮθεροποίηση των MTs. Επίσης δρĮ ĮνεξάρτητĮ Įπο τις υπόλοιες στους κινητοχώρους των χρωμοσωμάτων

Abbildung in dieser Leseprobe nicht enthalten

Saunderson and Clarke, Cur. Biol. (2006) 16, 12:R466-R468. doi:10.1016/j.cub.2006.05.032

Ο σχημĮτισμός κĮι η λειτουργίĮ του συμπλόκου εξĮρτάτĮι Įπό την ενεργότητĮ της Aurora A.

Η HURP προσδένετĮι στους μικροσωληνίσκους, όπως προĮνĮφέρθηκε, μέσω του άμινο-τελικού άκρου της, το οποίο μάλιστĮ είνĮι θετικά φορτισμένο κĮι επάγει μίĮ νέĮ διĮμόρφωση φύλλων τουμπουλίνης που περιελίσσοντĮι γύρω Įπό τĮ άκρĮ μικροσωληνίσκων σχημĮτίζοντĮς δύο ομόκεντρους σωλήνες. Σε Įυτόν τον ενĮλλĮκτικό σχημĮτισμό των δύο ομόκεντων σωλήνων ο εσωτερικός σωλήνĮς είνĮι ένĮς φυσιολογικός μικροσωληνίσκος, ενώ ο εξωτερικός Įποτελεί ένĮ φύλλο συντιθέμενο Įπό ĮντιπĮράλληλĮ πρωτοϊνίδιĮ τουμπουλίνης που διευθετούντĮι με Ρ2 συμμετρίĮ. Ο εξωτερικός σωλήνĮς βρίσκετĮι σε κλίση 42.5o σε σχέση με τον εσωτερικό. [[12]13]

ΕικόνĮ 1.9 Μοντέλο της διευθέτησης του πρωτοϊνιδίου μετĮξύ του εσωτερικού μικροσωληνίσκου (κίτρινος κύλινδρος) κĮι του εξωτερικού φύλλου επĮγόμενου Įπό την HURP. Με κόκκινο ĮνĮπĮριστόντĮι οι κινεσίνες.

Abbildung in dieser Leseprobe nicht enthalten

Sandarella et al.,J. Mol.Biol (2006)365, 5:1587-1595. doi:10.1016/j.jmb.2006.10.064

Ο λειτουργικός ρόλος Įυτής της ιδιότητĮς της HURP έγκειτĮι στη στĮθεροποίηση κĮι δεσμοποίηση των μικροσωληνίσκων μέσω της μείωσης του ρυθμού κĮτĮστροφής/διάσωσης τους in vivo, κĮι έχει την ικĮνότητĮ νĮ προάγει τον πολυμερισμό των μικροσωληνίσκων που εμπυρηνόνωντĮι Įπό τους κινητοχώρους Įλλά όχι Įπό τĮ κεντροσωμάτιĮ.

ΜιĮ άλλη κρίσιμη λειτουργείĮ της HURP είνĮι ο ρόλος που κĮτέχει στο σημείο ελέγχου του ομĮλού σχημĮτισμού της Įτράκτου. Εκεί η HURP συμμετέχει στη στοίχιση κĮι το διĮχωρισμό των χρωμοσωμάτων. Εν΄ ĮπουσίĮ της η άτρĮκτος σχημĮτίζετĮι ĮνώμĮλĮ κĮι το εν λόγω σημείο ελέγχου πĮρĮκάμπτετĮι. [6, 7]

Η HURP ενεργοποιείτĮι με φωσφορυλίωση του κĮρβοξυ-τελικού Įκρου της HURP Įπό την κινάση σερίνης-θρεονίνης Aurora A.

ΧĮρĮκτηρίζετĮι Įπο μιĮ ενδομοριĮκή ĮλληλεπίδρĮση μετĮξύ του άμινοτελικού κĮι κĮρβόξυ-τελικού άκρου της.

Η ικĮνότητĮ πρόσδεσης της στους μικροσωληνίσκους ιφίστĮτĮι μέσω της άμινο-τελικής επικράτειĮς. ΟτĮν το κĮρβόξυ-τελικό άκρο είνĮι Įποφοσφορυλιωμένο , Įλληλεπιδρά με το άμινο-τελικό άκρο , κĮλύπτοντĮς την ĮλληλουχίĮ υπεύθυνη γιĮ την συγγένειά του γιĮ τους μικροσωληνίσκους.

ΟτĮν η Aurora A φωσφορυλιώνει το κĮρβόξυ-τελικό άκρο , το Įμινοτελικό άκτο ĮπελευθερώνετĮι κĮι ĮποκĮλύπτετĮι η περιοχή πρόσδεσης στους μικροσωληνίσκους. Η φωσφορυλίωση λĮμβάνει χώρĮ μετά το σχημĮτισμό του συμπλόκου που συμετέχει στο σχημĮτισμό της μιτωτικής Įτράκτου. ΕπιπρόσθετĮ, δεν είνĮι ξεκάθĮρο Įν ο σχημĮτισμός του συμπλοκου Įυτού εξĮρτάτĮι Įπο τους μικροσωληνίσκους ή όχι.

Η Aurora A ενεργοποιείτĮι ότĮν η TPX2 ĮπελεθερώνετĮι Įπο τις ιμπορτίνες κĮι φοσφωρυλιώνει την Aurora A σε κĮτάλοιπο σερίνης. Επίσης, η ΤΡΧ2 επηρεάζει τον εντοπισμό της Aurora A στους μικροσωληνίσκους της Įτράκτου ενω ĮντίθετĮ, η Aurora A δεν επηρεάζει τον εντοπισμό της ΤΡΧ2. [20] Η ενεργοποίησή της Aurora A εξĮρτάτĮι Įπό την ĮλληλεπίδρĮση με τĮ υποστρώμĮτά της κĮι Įπό την ικĮνότητĮ Įυτοφωσφορυλίωσης της. Η Aurora A με την πρόσδεση της TPX2 ĮυτοφωσφορυλιώνετĮι σε κĮτάλοιπο θρεονίνης στο βρόγχο ενεργοποίησης κĮι με Įυτό τον τρόπο ενεργοποιείτĮι. Χωρίς την ΤΡΧ2, η πρόσδεση υποστρωμάτων Įπό την κινάση επάγει ένĮ σχημĮτισμό που δίνει το βĮσικό επίπεδο ενεργότητĮς της Aurora A. [[19],20] Ωστόσο η ίδιĮ η ΤΡΧ2 ενώ ενεργοποιεί την Aurora A , Įποτελεί τĮυτόχρονĮ κĮι στόχο της Aurora A κĮι τελικĮ φωσφορυλιώνετĮι Įπο Įυτή.

Η Įπελευθέρωση της TPX2 είνĮι ĮποτέλεσμĮ της δράσης της Ran-GTΡ. Η ένθεση TPX2 σε εκχυλίσμĮτĮ Įυγών βĮτράχου Xenopus προκĮλεί το σχημĮτισμό δομής ĮστέρĮ ĮλλĮ όχι τη δομή ψευδοĮτράκτου [[13].14] ΑπουσίĮ TPX2 δίνει πĮρόμοιο φĮινότυπο με τη Įποσιώπηση της HURP ĮλλĮ Įποδείχθηκε πως οι δύο πρωτεΐνες δεν έχουν συμπληρωμĮτική ή πλεονάζουσĮ λειτουργίĮ κĮι γενικά, είνĮι Įνεξάρτητες η μιĮ Įπο την άλλη [[24]]. ΠĮρόλĮ Įυτά , κĮτέχει σημĮντικό ρόλο στην οργάνωση των πόλων κĮι στην ĮκερĮιότητĮ των κεντροσωμάτων.

Η Aurora A κĮθώς κĮι οι άλλες κινάσες Aurora στον άνθρωπο: Aurora B κĮι Aurora C έχουν πολλĮπλούς ρόλους (οι οποίοι μάλιστĮ διĮφέρουν ĮνάλογĮ με το στάδιο του κυττĮρικού κύκλου) κĮι υπερεκφράζοντĮι σε πολλά είδη κĮρκίνου, υπογρĮμμίζοντĮς τη σημĮσίĮ τους γιĮ την ομĮλή διεξĮγωγή του κυττĮρικού κύκλου.

To πρότυπο έκφρĮσης της ΗURP συμβĮδίζει με Įυτή της Aurora A τόσο χρονικά όσο κĮι στη κĮτĮνομή της συγκέντωσης της στο κύττĮρο. Dzτσι, η HURP κĮι η Aurora A είνĮι σε μέγιστĮ επίπεδĮ κĮτĮ τη φάση G2/M ενώ πριν τη κυττĮροκίνηση , στο τέλος της ĮνάφĮσης, εκλείπουν. ΚĮτĮ την ένĮρξη της μίτωσης μάλιστĮ εντοπίζοντĮι κυρίως κοντά στους κινητοχώρους των χρωμοσωμάτων.

Abbildung in dieser Leseprobe nicht enthalten

Wilde A., J Cell Biol. 2006 Jun 19;173(6):829-31. ΕικονĮ 1.10 θεωρητικό μοντέλο δράσης του συμπλόκου της HURP

Στο συμπλοκο με τη HURP συμμετέχει εκτός Įπο την TPX2 κĮι μιĮ άλλη MAP, η ΧΜΑΡ215, η οποίĮ στον άνθρωπο ονομάζετĮι hTOG κĮι ευθύνετĮι γιĮ τον γρήγορο πολυμερισμό των μικροσωλινίσκων προς το θετικό τους άκρο. [[25]] Επιπλέον, συμμετέχει στο σχημĮτισμό της Įτράκτου οπου η δράση της ρυθμίζετĮι Įπο την Įπελευθέρωση της Įπο τις ιμπορτίνες μέσω της RanGTP. Επίσης, Įλληλεπιδρά με την TACC κĮι με τη λĮμινίνη Β που βοηθά στο σχημĮτισμό του υλικού περιβλήμĮτος της Įτράκτου. [[25],26]. Αξίζει νĮ σημειωθεί οτι η TACC ενεργοποιείτĮι Įπο την Aurora A κĮτĮ την ωρίμĮνση των κεντροσωμάτων κĮι η ĮλληλεπίδρĮσή της με την ΧΜΑΡ215 προωθεί των σχημĮτισμό των μικροσωληνίσκων (ΜΤs).

Τέλος γιĮ την ολοκλήρωση του συμπλόκου της HURP, ĮπĮιτείτĮι η ĮλληλεπίδρĮση με τη κινεσίνη Eg5, μέλος της οικογένειĮς BimC, που πĮίζει ρόλο στην εγκĮθίδρυση κĮι τη διĮτήρηση της διπολικότητĮς της Įτράκτου. Dzτσι, ενέχετĮι στην διπολικότητĮ της Įτράκτου κĮι είνĮι πολύ σημĮντική γιĮ τη ροή προς τον πόλο των μικροσωληνίσκων που προκĮλεί το διĮχωρισμό των χρωμοσωμάτων. Επίσης, μπορεί κĮι ολισθĮίνει χωριστά πάνω στους ĮντιπĮράλληλους μικροσωληνίσκους, υποβοηθώντĮς το διĮχωρισμό των χρωμοσωμάτων κĮτĮ την ĮνάφĮση. Η Eg5 Įποτελεί υπόστρωμĮ της Aurora A. [[26]]

ΣυμπερĮίνοντĮς, η HURP είνĮι μίĮ πρωτεΐνη κρίσιμη γιĮ την ĮκερĮιότητĮ του κυττĮρικού κύκλου κĮι της ορθής διĮίρεσης του κυττάρου. Η συσχέτιση της HURP με το ηπĮτοκυττĮρικό κĮρκίνωμĮ έγγειτĮι στο γεγονός οτι τόσο η υπερέκφρĮση της όσο κĮι η Įποσιώπηση της, Įπορυθμίζουν το κυττĮρικό κύκλο.

Dzτσι η ĮνĮγνώριση των Įλληλεπιδράσεων που πĮίρνουν μέρος ĮνάμεσĮ στĮ συστĮτικά που σχημĮτίζουν το σύμπλοκο της HURP κĮι η ρύθμιση στην οποίĮ υπόκειντĮι, Įλλά κĮι ενδομοριĮκές Įλληλεπιδράσεις της HURP που τη ρυθμίζουν ενδογενώς, Įποτελούν Įντικείμενο έρευνĮς που προσελκύει μεγάλο ενδιĮφέρον.

ΘĮ πρέπει νĮ σημειωθεί , πως πρόσφĮτĮ βρέθηκε μιĮ ομόλογη πρωτεΐνη της HURP (Mars) κĮι σε έντομĮ όπως η Drosophila Melanogaster, ĮλλĮ φĮινομενικά δεν πĮρουσιάζουν Įνάλογες λειτουργίες. [[26]] Ωστόσο η ĮλληλουχίĮ της είνĮι συντηρημένη ĮνάμεσĮ στĮ είδη κĮι είνĮι πολύ πιθĮνό νĮ κĮτέχει ρόλο στην επιβίωση των κυττάρων κĮι της D. Melanogaser. Ακομη σε in vivo μελέτες διĮπιστώθηκε οτι η Įποσιώπηση της HURP σε ποντίκιĮ (knock-out mice) οδηγεί σε στειρότητĮ των θηλυκών . Ενώ η γονιμοποίηση διεξάγετĮι φυσιολογικά , το επιθήλιο της μήτρĮς δεν επιτρέπει την εμφύτευση του εμβρύου. Η HURP σε Įυτή τη περίπτωση διĮτĮράσει τον πολλĮπλĮσιĮμό των επιθηλιĮκών Įυτών κυττάρων ενώ η έκφρĮση της στη μήτρĮ φάινετĮι νĮ ρυθμίζετĮι ορμονικά [[27]]

Σκοπός της πĮρούσĮς εργĮσίĮς ήτĮν νĮ μελετηθούν οι ενδομοριĮκές Įλληλεπιδράσεις μετĮξύ του κĮρβόξυ-τελικού κĮι Įμινο-τελικού άκρου της HURP κĮι η διĮπίστωση εĮν τĮ δυο Įυτά άκρĮ κĮι η ενδομοριĮκή τους ĮλληλεπίδρĮση επηρεάζει ή επηρεάζετĮι Įπο δείγμĮ εχυλισμĮτων κυττάρων θυλĮστικών in vitro . Γι’ Įυτό το λόγο, πρĮγμĮτοποιήθηκε έκφρĮση σε βĮκτηριĮκά κύττĮρĮ της πρωτεΐνης τoυ κĮρβοξυ-τελικού κĮι του Įμινο- τελικού τμημάτων της. ΠĮρĮγμĮτοποιήθηκĮν εκτενείς προσπάθειες γιĮ το βέλτιστο κĮθĮρισμό των εν λόγω τμημάτων κĮι ότĮν επετεύχθει ικĮνοποιητική Įπομόνωση των πρωτεϊνών ως προς τη ποσότητĮ της κĮι την κĮθĮρότητĮ τους (purity ) Įυτές χρησιμοποιήθηκĮν γιĮ νĮ κĮτĮκρημνίσουν άλλες πρωτεΐνες Įπό μιτωτικά εκχυλίσμĮτĮ κυττάρων HeLa. Dzτσι έγινε προσπάθειĮ νĮ ĮνĮγνωριστούν άλλες πρωτεΐνες με τις οποίες ίσως Įλληλεπιδρούν τĮ τμήμĮτĮ Įυτά. Τυχό Įλληλέπιδράσεις θĮ χĮρτογρĮφούντĮν είδικĮ στο Įμινο - κĮι κĮρβόξυ-τελικό τμήμĮ της HURP ή θĮ σχετίζοντĮν με τη μετĮξύ τους ενδομοριĮκή ĮλληλεπίδρĮση.

2. ΥΛΙΚΑ ΚΑΙ ΜΕΘΟΔΟΙ

2.1 ΥΛΙΚΑ

2.1.1 ΒĮκτηριĮκά στελȑχη του βĮκτηρίου Escherichia coli (E.Coli)

Abbildung in dieser Leseprobe nicht enthalten

2.1.2 Φορείς κλωνοποίησης

Abbildung in dieser Leseprobe nicht enthalten

Dzχει προέλθει Įπό τον pET28a όπου προστέθηκε το GST-tag κομμένο με τĮ περιοριστικά ένζυμĮ VspI-NdeI. Το σημείο πέψης με θρομβίνη ĮπομĮκρύνθηκε με μετĮλλĮξιγένεση σημείου. Περιέχει στο άμινο-τελικό άκρο 6xHis-tag, Įκολουθούμενο Įπό GST-tag κĮι σημείο πέψης Įπό θρομβίνη.

Μέγεθος: 5369bp

Περιέχει T7 υποκινητή

MCS: 5’ BamHI - EcoRI - SacI - SalI - HindIII - NotI - XhoI 3’

ΤĮ N, M, C τμήμĮτĮ κĮι ολόκληρο το γονίδιο της HURP, hurp έχουν κλωνοποιηθεί με πέψη στĮ σημείĮ κοπής περιοριστικών ενζύμων BamHI - XhoI.

pET28a

Abbildung in dieser Leseprobe nicht enthalten

Novagen vectors pET-28a DNA Cat. No 69864-3

Μέγεθος: 5369bp

Περιέχει T7 Yποκινητή

MCS: 5’ BamHI - EcoRI - SacI - SalI - HindIII - NotI - XhoI 3’

ΤĮ τμήμĮτĮ Ν1 κĮι Ν2 έχουν κλωνοποιηθεί με κοπή στις θέσεις των περιοριστικών ενζύμων NdeI - XhoI, ώστε νĮ ĮφĮιρεθεί κĮι το Τ7- tag κĮι νĮ έχουν στο άμινο-τελικό άκρο 6xHis - tag

pET21d

Abbildung in dieser Leseprobe nicht enthalten

Μέγεθος: 5440bp

T7 υποκινητής , MCS: 5’ BamHI - EcoRI - SacI - HindIII - NotI - XhoI 3’ Το γονίδιο της hAurora A έχει κλωνοποιηθεί με BamHI - XhoI κĮι έχει στο κάρβοξυ-τελικό άκρο 6xHis - tag.

pT 7-7/C

Abbildung in dieser Leseprobe nicht enthalten

Μέγεθος: 2743bp

Υποκινητής φάγου Τ7

Υποκινητής βĮκτηριοφάγου Τ7

MCS: 3’ ClaI - HindIII - PstI - SalI - XbaI - BamHI - EcoRI - NdeI 5’ RBS: T7 βĮκτηριοφάγος ATG γονίδιο 10 βĮκτηριοφάγου Τ7

ΤĮ his-hurp, his-N, his-M, his-C έχουν κλωνοποιηθεί με πέψη στις περιοριστικές θέσεις NdeI - BamHI.

2.1.3 Υλικά κĮι μηχĮνήμĮτĮ που πĮρĮλĮμβάνοντĮι Įπο τις ετĮιρίες πĮρĮσκευής τους

- ΜάρτυρĮς ΜοριĮκών ΒĮρών DNA O’ Gene Ruler DNA Ladder Mix, Fermentas
- Χρωστική 6x Orange Loading Dye, Fermentas
- Χρωστική DNA Gel Loading Buffer 10x, Eppendorf
- Πρωτεϊνικός ΜάρτυρĮς ΜοριĮκών ΒĮρών Smart Broad-Range Protein Standard, GenScript Corporation
- Πρωτεϊνικός ΜάρτυρĮς ΜοριĮκών ΒĮρών PiNK Prestained Protein Ladder, NIPPON Genetics EUROPE GmbH
- Θρεπτικό μέσο βĮκτηρίων LB Broth, Molecular Biology Tested, Sigma
- Θρεπτικό μέσο βĮκτηρίων LB Agar, Molecular Biology Tested, Sigma
- Ρητίνη μετĮλλικής συγγένειĮς γιĮ ιόντĮ Ni2+ Protino® Ni-TED Resin, Macherey-Nagel
- ΔιάλυμĮ Bradford, BIORAD
- Μεμβράνη διĮπίδυσης Spectra/PRO molecular porous membrane tubing, MWCO: 3,500
- Χρώση SYPRO orange ,Invitrogen 5000x σε 100% DMSO

Φυγόκεντροι:

o επιτρĮπέζιĮ ψυχόμενη φυγόκεντρος centrifuge 5417 R, Eppendorf o επιτρĮπέζιĮ ψυχόμενη φυγόκεντρος centrifuge 5810 R, Eppendorf o επιδĮπέδιĮ ψυχόμενη φυγόκεντρος SORVAL evolution RC

ΜηχάνημĮ FPLC:

- Pharmacia BioTech FPLC system

Pharmacia BioTech FPLC system περιλĮμβάνει τĮ εξής επιμέρους τμήμĮτĮ: 2 P-500 Pumps (Įντλίες) , 1 LCC-501 Plus Controller , 1 LKB Redifrac Fraction Collector (συλλέκτης σωληνĮρίων), 1 UV-MII monitor (λάμπĮ υπεριώδους ĮκτινοβολίĮς), 1 Conductivity Detector (Įνιχνευτής), 1 MV-7 Valve, 2 MV-8 Valves, 1 Mixer (5MPa) (μίκτης) κĮι θήκη ενĮπόθεσης σωληνĮρίων

Abbildung in dieser Leseprobe nicht enthalten

2.1.4 STOCK ΔΙΑΛΥΜΑΤΑ [[26]]

2.1.4.1 ANTIBIOTIKA

Ampicillin (Įμπικιλλίνη) stock ΔιάλυμĮ Συγκȑντρωσης 50mg/ml

ΔιĮλύουμε 1gr ampicillin σε ddH20 μέχρι τελικό όγκο 20ml. Φιλτράρουμε το διάλυμĮ με φίλτρο που έχει διάμετρο πόρου 0.22μm, μοιράζουμε σε μερίδες 1ml κĮι φυλάσσουμε στους -20[0]C.

(ΧρησιμοποιείτĮι συνήθως σε ĮρĮίωση 1:1000, δηλĮδή σε τελική συγκέντρωση 50μg/ml)

Chloramphenicol (χλωρĮμφενικόλη) stock ΔιάλυμĮ Συγκȑντρωσης 50mg/ml

ΔιĮλύουμε 1gr chloramphenicol σε Įπόλυτη ĮιθĮνόλη μέχρι τελικό όγκο 20ml. Φιλτράρουμε το διάλυμĮ με φίλτρο που έχει διάμετρο πόρου 0.22μm, μοιράζουμε σε μερίδες 1ml κĮι φυλάσσουμε στους -20[0]C. ( ΧρησιμοποιείτĮι συνήθως σε ĮρĮίωση 1:1.000, δηλĮδή σε τελική συγκέντρωση 50μg/ml)

Kanamycin (κĮνĮμυκίνη) stock ΔιάλυμĮ Συγκȑντρωσης 50mg/ml

ΔιĮλύουμε 1gr kanamycin σε ddH20 μέχρι τελικό όγκο 20ml. Φιλτράρουμε το διάλυμĮ με φίλτρο που έχει διάμετρο πόρου 0.22μm, μοιράζουμε σε μερίδες 1ml κĮι φυλάσσουμε στους -20[0]C.

(ΧρησιμοποιείτĮι συνήθως σε ĮρĮίωση 1:1.000, δηλĮδή σε τελική συγκέντρωση 50μg/ml)

2.1.4.2 ΟΞΕΑ-ΒΑΣΕΙΣ ΚΑΙ ΑΛΑΤΑ

KOH (υδροξείδιο του κĮλίου ή κĮυστικό κάλιο) 5N ΠΡΟΣΟΧΗ! Η πĮρĮσκευή Įυτού του διĮλύμĮτος δίνει μιĮ ισχυρά εξώθερμη ĮντίδρĮση η οποίĮ μπορεί νĮ προκĮλέσει θρĮύση σε γυάλινĮ δοχείĮ κĮι γι' Įυτό ενδείκνυτĮι η χρήση πλĮστικού δοχείου.

ΔιĮλύουμε 7,455gr ΚΟΗ pellets σε ddH20 μέχρι τελικό όγκο 100ml υπό συνεχή Įνάδευση. Ως επιπρόσθετη πĮράμετρο προφύλĮξης, κρĮτάμε το δοχείο στον πάγο κĮτά την διάρκειĮ προετοιμĮσίĮς του διĮλύμĮτος.

Δεν Įποστειρώνουμε. Φυλάσσουμε σε πλĮστικό δοχείο σε θερμοκρĮσίĮ δωμĮτίου.

HCl (υδροχλωρικό οξύ)

ΠΡΟΣΟΧΗ! ΕίνĮι πολύ πτητικό κĮι έντονĮ διĮβρωτικό. Ο χειρισμός του πυκνού HCl γίνετĮι με πολύ προσοχή, σε hood ώστε νĮ Įποφευχθεί η εισπνοή του. Φοράμε πάντĮ γάντιĮ κĮι εργĮστηριĮκή ποδιά. Δεν Įποστειρώνουμε κĮι φυλλάσουμε σε θερμοκρĮσίĮ δωμĮτίου.

ΗCl (υδροχλωρικό οξύ) 1N

Η διĮδικĮσίĮ πĮρĮσκευής του διĮλύμĮτος πρĮγμĮτοποιείτĮι σε hood. ΑνĮμιγνύουμε 3,65ml πυκνό HCl με ddH20 μέχρι τελικό όγκο 100ml. ΠΡΟΣΟΧΗ! Δεν Įποστειρώνουμε. Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

ΜnCl2 (χλωριούχο μĮγγάνιο) 1Μ

ΔιĮλύουμε 19,79gr ΜnCl2 σε ddH20 μέχρι τελικό όγκο 100ml .

Το διάλυμĮ δεν ĮποστειρώνετĮι. ΦυλάσσετĮι σε θερμοκρĮσίĮ δωμĮτίου.

MgSO4 (θειϊκό μĮγνήσιο) 1Μ

ΔιĮλύουμε 49,3gr MgSO4 σε ddH20 μέχρι τελικό όγκο 200ml. Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

NaCl (χλωριούχο νάτριο) 5Μ

ΔιĮλύουμε 292,2gr NaCl σε ~800ml ddH20, μέχρι τελικό όγκο 1L. Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

MgCl2 (χλωριούχο μĮγνήσιο) 1Μ

ΔιĮλύουμε 20.33gr MgCl2 σε ddH20 κĮι προσθέτουμε μέχρι τελικό όγκο 100ml.

Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

Sodium Acetate (οξικό νάτριο, CH3COONa) 3M pH 5.2

ΔιĮλύουμε 40.83gr sodium acetate σε ddH20 μέχρι τελικό όγκο 100ml. Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

Tris pH 7.5 1M

ΔιĮλύουμε 12.11gr Tris base σε περίπου 60ml ddH20. IσοστĮθμίζουμε το pH (7.5) με πυκνό HCl κĮι προσθέτουμε ddH20 μέχρι τελικό όγκο 100ml. Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

Tris pH 8.0 1M

ΔιĮλύουμε 12.11gr Tris base σε περίπου 60ml ddH20. IσοστĮθμίζουμε το pH με πυκνό HCl κĮι προσθέτουμε ddH20 μέχρι τελικό όγκο 100ml.

Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

PBS (Phosphate-buffered Saline) 1Χ (1L)

Abbildung in dieser Leseprobe nicht enthalten

ΔιĮλύουμε 8gr NaCl, 0.2gr KCl, 1.78gr Na2HPO4 κĮι 0.27gr KH2PO4 σε ddH20 μέχρι τελικό όγκο 1000ml. Η τιμή του pH προκύπτει κοντά στο 7.5 οπότε δεν είνĮι ĮπĮρĮίτητη η ισοστάθμιση του pH.

Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

2.1.4.3 ΔΙΑΛΥΜΑ ΓΙΑ ΗΛΕΚΤΡΟΦΟΡΗΣΗ ΣΕ ΠΗΚΤΩΜΑ ΑΓΑΡΟΖΗΣ

ΤΒΕ 10x pH 8.3 (1L)

Abbildung in dieser Leseprobe nicht enthalten

ΔιĮλύουμε 108gr Tris base, 55gr boric acid κĮι 9.3gr EDTA σε ddH20 μέχρι τελικό όγκο 1L. Η τιμή του pH προκύπτει κοντά στο 8.3 οπότε δεν είνĮι ĮπĮρĮίτητη η ισοστάθμιση του pH.

Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

2.1.4.4 ΔΙΑΛΥΜΑΤΑ ΓΙΑ ΗΛΕΚΤΡΟΦΟΡΗΣΗ ΣΕ ΠΗΚΤΩΜΑ ΑΚΡΥΛΑΜΙΔΗΣ ( SDS-PAGE)

Tris pH 8.8 1.5M

ΔιĮλύουμε 18.17gr Tris base σε περίπου 70ml ddH20. IσοστĮθμίζουμε το pH με πυκνό HCl κĮι προσθέτουμε ddH20 μέχρι τελικό όγκο 100ml. Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

Tris pH 6.8 1M

ΔιĮλύουμε 12.11gr Tris base σε περίπου 70ml ddH20. IσοστĮθμίζουμε το pH με πυκνό HCl κĮι προσθέτουμε ddH20 μέχρι τελικό όγκο 100ml. Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

SDS 10% ( θειϊκό δωδεκĮκυλικό νάτριο) (100ml)

Η διĮδικĮσίĮ πĮρĮσκευής του διĮλύμĮτος πρĮγμĮτοποιείτĮι σε hoοd. ΔιĮλύουμε 10gr SDS σε ddH20 κĮι προσθέτουμε μέχρι τελικό όγκο 100ml. ΦυλάσσετĮι σε θερμοκρĮσίĮ δωμĮτίου.

APS (ammonium persulfate) 10% ΔιĮλύουμε 0.2gr APS σε 2ml ddH20. Φυλάσσουμε στους 40C.

Το ammonium persulfate διĮσπάτĮι Įργά σε υδĮτικό διάλυμĮ, γι’Įυτό ĮντικĮθιστούμε το διάλυμĮ κάθε 2-3 εβδομάδες.

Tris-glycine 20x (1L)

25mΜ Tris base

190mM glycine

ΔιĮλύουμε 30.28gr Tris base κĮι 142,6gr glycine σε ddH2O μέχρι τελικό όγκο 1L. Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

ΒSA (Bovine Serum Albumin) 10mg/ml

Ζυγίζουμε 0.01 gr BSA κĮι διĮλύουμε σε τελικό όγκο 1ml NaPi pH 7.6 , ώστε η τελική συγκέντρωση νĮ είνĮι 10mg/ml. Η BSA συνήθως χρησιμοποιείτĮι σε συγκέντρωση 1mg/ml. Η ĮρĮίωση της γίνετĮι με τη προσθήκη 100μl BSA 10mg/ml σε 900μl NaPi.

DTT (dithiothreitol) 1M

ΔιĮλύουμε 1.54 gr DTT σε ddH2O μέχρι τελικό όγκο 10ml. Φιλτράρουμε με φίλτρο διĮμέτρου πόρου 0.22μm.

Μοιράζουμε σε μερίδες 1ml κĮι φυλάσσουμε στους -20οC.

PMSF (phenylmethylsulfonyl fluoride) 200mM

ΔιĮλύουμε 0.35gr PMSF σε Įπόλυτη ĮιθĮνόλη μέχρι τελικό όγκο 10ml. Προσοχή, η σκόνη διĮλύετĮι δύσκολĮ. Φιλτράρουμε με φίλτρο διĮμέτρου πόρου 0.22μm.

Μοιράζουμε σε μερίδες κĮι φυλάσσουμε σε σκοτεινό μέρος στους -20[0]C.

SDS loading buffer 2x (SDS διάλυμĮ φόρτωσης δειγμάτων) (10ml)

Abbildung in dieser Leseprobe nicht enthalten

ΔιĮλύουμε πρώτĮ 0.8 gr SDS κĮι 0.02gr bromophenol blue σε 1ml Tris-HCl κĮι φιλτράρουμε με φίλτρο διĮμέτρου πόρου 0.22μm. Στη συνέχειĮ προοσθέτουμε 2ml Įποστειρωμένης γλυκερόλης 87% κĮι ddH2O μέχρι τĮ 10 ml.

Μοιράζουμε σε μερίδες 1ml κĮι φυλάσσουμε στους -20[0]C. Πριν τη χρήση προσθȑτουμε 200mM DTT.

Laemmli buffer 10x (ΔιάλυμĮ ΤρεξίμĮτος gel ΑκρυλĮμίδης ) (1L)

Abbildung in dieser Leseprobe nicht enthalten

ΔιĮλύουμε 10gr SDS, 142.63 gr glycine κĮι 30.28 gr Tris base σε ddH2O μέχρι τελικό όγκο 1L.

Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

Separating SDS gel 10% (ΠήκτωμĮ ΔιĮχωρισμού)

Abbildung in dieser Leseprobe nicht enthalten

Stacking SDS gel 5% (ΠήκτωμĮ ΠĮκετĮρίσμĮτος)

Abbildung in dieser Leseprobe nicht enthalten

Η προσθήκη APS κĮι TEMED γίνετĮι με τη σειρά που ĮνĮγράφοντĮι κĮι Įφού προστεθούν τĮ υπόλοιπĮ συστĮτικά του μίγμĮτος γιĮ νĮ ξεκινήσει ο πολυμερισμός των πηκτωμάτων ĮκρυλĮμίδης.

ΠΡΟΣΟΧΗ!

- Το SDS είνĮι νευροτοξικό κĮι γι’Įυτό ο χειρισμός του γίνετĮι με εργĮστηριĮκή ποδιά κĮι γάντιĮ.
- Το TEMED είνĮι κĮρκινογόνο. Η χρήση του γίνετĮι με εργĮστηριĮκή ποδιά κĮι γάντιĮ. Το εκθέτουμε όσο το δυνĮτόν λιγότερο στην ĮτμόσφĮιρĮ.

Coomassie Brilliant Blue Stain (ΔιάλυμĮ Χρώσης ΠηκτώμĮτος ΑκρυλĮμίδης) (200ml)

ΔιĮλύουμε 0.2gr Coomassie Brilliant Blue R250 σε 90% 1:1 ddH2O:ΜεθĮνόλη κĮι 10% οξικό οξύ μέχρι τελικό όγκο 200ml. Φιλτράρουμε με διηθητικό χĮρτί Whattmann κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου. Το διάλυμĮ μπορεȓ νĮ επĮνĮȤρησιμοποιηθεȓ πολλĮπλές φορές.

Destain Buffer ( ΔιάλυμĮ ΑποχρωμĮτισμού) (1L)

ΑποτελείτĮι Įπο:

20% Απόλυτη ΑιθĮνόλη κĮι

10% Οξικό οξύ

ΑνĮμιγνύουμε 200ml Įπόλυτης ĮιθĮνόλης με 100ml οξικό οξύ κĮι συμπληρώνουμε με ddH2O εως το 1L.

Φυλάσουμε σε θερμοκρĮσίĮ δωμĮτίου.

2.1.4.5 ΔιĮλύμĮτĮ γιĮ AνĮσοĮποτύπωση κĮτĮ Western

Tris-Glycine 10x

ΔιĮλύουμε 30.28gr Tris κĮι 142.63gr Glycine σε ~800ml ddH2Ο κĮι στη συνέχειĮ συμπληρώνουμε με ddH2Ο έως τελικό όγκο 1L. Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

Transfer Buffer

20% Įπόλυτη ĮιθĮνόλη 10% 1x Tris-Glycine ΑνĮμιγνύουμε 200ml Įπόλυτης ĮιθĮνόλης με 100ml Tris-Glycine κĮι συμπληρώνουμε με ddH2O έως το 1L. Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

Χρώση Ponceau-S

5% οξικό οξύ

0.5% Ponceau-S

ΔιĮλύουμε 0.5gr Ponceau-S σε 5ml οξικό οξύ κĮι ~80ml ddH2O κĮι στη συνέχειĮ συμπληρώνουμε με ddH2O έως τελικό όγκο 100ml. ΦυλάσσετĮι σε θερμοκρĮσίĮ δωμĮτίου.

Το διάλυμĮ επĮνĮȤρησιμοποιεȓτĮι.

PBS-T wash buffer

0.5% Tween 20 1x PBS

ΑνĮμιγνύουμε 5ml Tween 20 με 1x PBS σε τελικό όγκο 1L. Φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

ΔιάλυμĮ προυβριδοποίησης (Blocking Buffer)

0.5% Τween 20

1x PBS

5% άπĮχο γάλĮ σε σκόνη

ΔιĮλύουμε 2.5gr άπĮχο γάλĮ σε σκόνη σε ~30ml PBS-T κĮι στη συνέχειĮ συμπληρώνουμε με PBS-T έως τελικό όγκο 50ml.

Φυλάσσουμε στους 4oC.

ΔιάλυμĮ υβριδοποίησης

Πρωτογενές ή δευτερογενές ĮντίσωμĮ (1:2000 ή 1:10000 Įράιωση ĮντίστοιχĮ)

ΑνĮμιγνύουμε 10μl πρωτογενούς ĮντισώμĮτος με blocking buffer σε τελικό όγκο 20ml. Φυλάσσουμε στους -20oC.

ΔιάλυμĮ Įπογύμνωσης της μεμβράνης (Stripping buffer)

62.5 mM Tris pH6.7

2% SDS

7mM β-μερκĮπτοĮιθĮνόλη(β-ΜΕ)

ΑνĮμιγνύουμε 6.25ml Tris pH6.7 , 20ml SDS 10% , 700μl β-ΜΕ με ddH2O σε τελικό όγκο 100ml.

o Προσοχή. Η β-μερκĮπτοĮιθĮνόλη είνĮι νευροτοξική κĮι το διάλυμĮ πĮρĮσκευάζετĮι σε hood.

ΦυλάσσετĮι σε θερμοκρĮσίĮ δωμĮτίου. Μπορεȓ νĮ επĮνĮȤρησιμοποιηθεȓ δυο με τρεις φορές.

2.1.4.6 ΆλλĮ stock ΔιĮλύμĮτĮ

PMSF (phenylmethylsulfonyl fluoride) 200mM

ΔιĮλύουμε 0.35gr PMSF σε Įπόλυτη ĮιθĮνόλη μέχρι τελικό όγκο 10ml.

Προσοχή, η σκόνη διĮλύετĮι δύσκολĮ. Φιλτράρουμε με φίλτρο διĮμέτρου πόρου 0.22μm.

Μοιράζουμε σε μερίδες κĮι φυλάσσουμε σε σκοτεινό μέρος στους -20[0]C.

Lysozyme (λυσοζύμη) 10mg/ml

ΔιĮλύουμε 0.2gr lysozyme σε ddH20 μέχρι τελικό όγκο 20ml. Μοιράζουμε σε μερίδες 1ml κĮι φυλάσσουμε στους -20[0]C. Φιλτράρουμε το διάλυμĮ προĮιρετικά με φίλτρο διĮμέτρου πόρου 0.22μm.

EDTA 0.5M pH 8.0

ΔιĮλύουμε 18.61gr EDTA σε 80ml ddH20. ΙσοστĮθμίζουμε το pH με ΝaOH (~2 pellets). Η σκόνη δεν θĮ διĮλυθεί πλήρως μέχρι το pH νĮ ρυθμιστεί κοντά στην τιμή 8.0.

Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

IPTG 1M

ΔιĮλύουμε 7.15gr IPTG σε ddH20 μέχρι τελικό όγκο 300ml. Φιλτράρουμε το διάλυμĮ με φίλτρου διĮμέτρου πόρου 0.22μm, μοιράζουμε σε μερίδες 1ml κĮι φυλάσσουμε στους -20[0]C.

DMSO (dimethyl sulphoxide)

Μοιράζουμε σε μερίδες κĮι φυλάσσουμε σε σκοτεινό μέρος στους -20[0]C.

Imidazole (ιμιδĮζόλιο) 1Μ (100ml)

ΔιĮλύουμε 6.8gr Imidazole σε ddH20 κĮι προσθέτουμε μέχρι τελικό όγκο 100ml. Αποστειρώνουμε κĮι φυλάσσουμε σε θερμοκρĮσίĮ δωμĮτίου.

ΔιάλυμĮ λύσης STET

Abbildung in dieser Leseprobe nicht enthalten

Το διάλυμĮ διĮτηρείτĮι σε θερμοκρĮσίĮ δωμĮτίου. Πριν Įπό τη χρήση

προσθέτουμε 1/10 του τελικού όγκου διάλυμĮ λυσοζύμης συγκέντρωσης 10mg/ml.

Τροποποιημȑνο ΔιάλυμĮ RIPA

Abbildung in dieser Leseprobe nicht enthalten

ΤĮ ĮντιδρĮστήριĮ διĮλύοντĮι σε PBS 1X. Το διάλυμĮ φιλτράτĮι κĮι φυλλάσετĮι στους 4[0]C.

- ΠΡΟΣΟΧΗ! Οι ĮνĮστολεις πρωτεĮσών κĮθώς κĮι το PMSF πρέπει νĮ έινĮι φρέσκĮ πριν τη χρήση

2.2 ΜΕΘΟΔΟΙ

2.2.1 Απομόνωση ΠλĮσμιδιĮκού DNA σε μικρή ή μεσσĮίĮ κλίμĮκĮ με τυποποιημȑνη συσκευĮσίĮ

Α. Απομόνωση πλĮσμιδιĮκου DNA σε μικρή κλίμĮκĮ με τη χρήση τυποποιημένης συσκευĮσίĮς.

ΓιĮ την Įπομόνωση πλĮσμιδιĮκού DNA σε μικρή κλίμĮκĮ

χρησιμοποιούμε την τυποποιημένη συσκευĮσίĮ Qiaprep® Spin

Miniprep Kit της ετĮιρείĮς Qiagen, η οποίĮ επιτρέπει τον κĮθĮρισμό έως κĮι 20μg high-copy(πολλĮπλών Įντιγράφων) πλĮσμιδίου κĮι έως 10μg low-copy(μικρού Įριθμού Įντιγράφων) πλĮσμιδίου. Το πρωτόκολλο που χρησιμοποιήθηκε είνĮι Įυτό που περιέχετĮι στο εγχειρίδιο της συσκευĮσίĮς

ΗμέρĮ 1η

1. ΕνοφθĮλμίζουμε 1-5ml υγρού θρεπτικού μέσου ( LB Broth ) το οποίο περιέχει το κĮτάλληλο Įντιβιοτικό όπου Įυτό χρειάζετĮι, με μονή ĮποικίĮ Įπο τριβλίο Petri, το οποίο περιέχει στέρεο θρεπτικό υλικό (LB Agar) κĮι το κĮτάλληλο Įντιβιοτικό.

2. Ανάπτυξη κĮλλιέργειĮς Ο/Ν *(overnight , 16 h) στους 37οC υπο Įνάδευση (200rpm ή 200 στροφές/λεπτό)

ΗμέρĮ 2η

3. Φυγοκεντρούμε στους 4οC, στις 3500 στρογές/λεπτό (rpm) γιĮ 20 λεπτά.

4. Το ίζημĮ ĮπομονώνετĮι κĮι επĮνĮδιĮλύετĮι σε 250 μl Ρ1 διάλυμĮ στο οποίο έχει προστεθεί RNAση . Το εκχύλισμĮ μετĮφέρετĮι σε 2ml eppendorf σωληνάκι.

5. Προσθήκη 250μl διĮλύμĮτος Ρ2 κĮι ĮνĮστροφή του σωληνĮρίου 4-

6 φορές- ήπιĮ.

- Δεν ĮνĮδεύουμε έντονĮ με vortex κĮθότι θέλουμε νĮ Įποφευχθεί η διάχυση του γενομικού DNA. Το διάλυμĮ πρέπει νĮ πάρει μιĮ μορφή ĮδιĮφĮνούς κολλώσους ιζήμĮτος. ΠΡΟΣΟΧΗ! Η ĮντίδρĮση της λύσης δεν πρέπει νĮ ξεπεράσει τĮ 5 λεπτά.

6. Προσθήκη 350 μl διĮλύμĮτος Ν3 κĮι άμεση Įνάδευση με ĮνĮστροφή του σωληνĮρίου. Το διάλυμĮ πĮίρνει μιĮ λευκή νεφελώδη όψη.

7. Φυγοκεντρούμε στĮ 17900g ( 13000 rpm) σε θερμοκρĮσίĮ δωμĮτίου (25οC) γιĮ 10 λεπτά. ΣχημĮτίζετĮι λευκό, συμπĮγές ίζημĮ.

8. Το υπερκείμενο μετĮφέρετĮι στη στήλη πρόσδεσης κĮι κĮθĮρισμού (Qiaprep spin column) ΠΡΟΣΟΧΗ! Μέγιστη χωρητικότητĮ κολώνĮς είνĮι 800μl. ΓιĮ διάλυμĮ μεγĮύτερου όγκου επĮνĮλĮμβάνοντĮι τĮ βήμĮτĮ 8 κĮι 9

9. Φυγοκεντρούμε στĮ 17900g ( 13000 rpm) σε θερμοκρĮσίĮ δωμĮτίου (25οC) γιĮ 1 λεπτό Το έκλουσμĮ ĮπομĮκρύνετĮι.

10. Η κολώνĮ ξεπλένετĮι με τη προσθήκη 0.5ml διĮλύμĮτος ΡΒ κĮι με επĮκόλουθη φυγοκέντρηση στĮ 17900g ( 13000 rpm) σε θερμοκρĮσίĮ δωμĮτίου (25οC) γιĮ 1 λεπτό Το έκλουσμĮ ĮπομĮκρύνετĮι.

11. ΠροστίθεντĮι 750μl διĮλύμĮτος ΡΕ ( με ĮιθĮνόλη) στη στήλη κĮι Įκολουθεί φυγοκέντρηση στĮ 17900g ( 13000 rpm) σε θερμοκρĮσίĮ δωμĮτίου (25οC) γιĮ 1 λεπτό Το έκλουσμĮ ĮπομĮκρύνετĮι.

12. Ακολοθεί επιπλέον φυγοκέντρηση στĮ 17900g ( 13000 rpm) σε θερμοκρĮσίĮ δωμĮτίου (25οC) γιĮ 1 λεπτό Το έκλουσμĮ κĮι πάλι ĮπομĮκρύνετĮι.

- το βήμĮ Įυτό πρĮγμĮτοποιείτĮι μετά την Įπομάκρυνση του εκλούσμĮτος του βήμĮτος 12 κĮι χωρίς την περĮιτέρω προσθήκη άλλου ĮντιδρĮστηρίου γιĮ την Įπομάκρυνση της επιπλέον ĮιθĮνόλης του διĮλύμĮτος ΡΕ που μπορεί νĮ ĮνĮστείλλει ενζυμĮτικές Įντιδράσεις.

13. Η στήλη τοποθετείτĮι σε ένĮ νέο σωληνάριο eppendorf 1.5ml. ΠροστίθεντĮι 50μl ορού ddH2O ( pH 7.0) στο κέντρο της στήλης . Ηστήλη επωάζετĮι γιĮ ένĮ λεπτό σε θερμοκρĮσίĮ δωμĮτίου κĮι Įκολουθεί φυγοκέντρηση στĮ 17900g ( 13000 rpm) σε θερμοκρĮσίĮ δωμĮτίου (25οC) γιĮ 1 λεπτό .

14. Το έκλουσμĮ Įποτελεί το πλĮσμιδιĮκό DNA . ΦυλάσσετĮι στους 4οC ή στους -20oC.

15. ΑνĮλύουμε 1-2μl διĮλύμĮτος DNA σε πήκτωμĮ ĮγĮρόζης 1% w/v γιĮ νĮ ποσοτικοποιηθεί η συγκέντρωση του.

- ΠΡΟΣΟΧΗ! Το πĮρĮπάνω προτόκολλο ĮνĮφέρετĮι στην

Įπομόνωση πλĮσμιδιĮκού DNA Įπο υψηλού ρυθμού ĮντιγρĮφής πλĮσμίδιĮ ( high copy) . Αν το επιθυμητό προς Įπομόνωση πλĮσμίδιο είνĮι χĮμηλού ρυθμού ĮντιγρĮφής (low copy ) το προτόκολλο τροποποιείτĮι ως εξής :

o ΕνοφθĮλμίζοντĮι 1-10 ml υγρού θρεπτικού υλικου (LB Broth ) με μονή ĮποικίĮ Įπο τριβλίο petri με στερεό θρεπτικό υλικό (LB Agar)

o Οι όγκοι που ĮνĮγράφοντĮι γιĮ τĮ διĮλύμĮτĮ Ρ1, Ρ2 κĮι Ν3 διπλĮσιάζοντĮι γιĮ 10 ml κĮλλιέργειĮ .

- ΤĮ διĮλύμĮτĮ Ρ1, Ρ2, Ν3, ΡΒ κĮι ΡΕ πĮρέχοντĮι Įπο τη συσκευĮσίĮ κĮι φυλάσσοντĮι στους 4οC .

ΠΡΟΣΟΧΗ !

- ΝΑ έχει προστεθεί RNAση Α στο Ρ1 (πĮρέχετĮι στη συσκευĮσίĮ) ωστε η τελική της συγκέντρωση νĮ είνĮι 100μg/ml
- ΝĮ έχει προστεθεί ΚĮτάλληλη ποσότητĮ ΑιθĮνόλης στο ΡΕ
- Το διάλυμĮ Ρ2 , πριν τη χρήση νĮ έχει έρθει σε

θερμοκρĮσίĮ δωμĮτίου κĮθότι περιέχει SDS το οποίο κĮθιζάνει στις χĮμηλες θερμοκρĮσίες Įποθήκευσης.

Β. Απομόνωση πλĮσμιδιĮκου DNA σε μεσĮίĮ κλίμĮκĮ με τη χρήση τυποποιημένης συσκευĮσίĮς.

ΓιĮ την Įπομόνωση πλĮσμιδιĮκού DNA σε μεσĮίĮ κλίμĮκĮ χρησιμοποιείτĮι η τυποποιημένη συσκευĮσίĮ QiafilterTM Plasmid Midi Kit της ετĮιρείĮς Qiagen, η οποίĮ επιτρέπει τον κĮθĮρισμό έως κĮι 100μg high-copy κĮι low-copy πλĮσμιδίων. . Το πρωτόκολλο που χρησιμοποιήθηκε είνĮι Įυτό που περιέχετĮι στο εγχειρίδιο της συσκευĮσίĮς.

ΗμέρĮ 1η

1. ΕνοφθĮλμίζουμε 2-5ml υγρού θρεπτικού μέσου ( LB Broth ) το οποίο περιέχει το κĮτάλληλο Įντιβιοτικό όπου Įυτό χρειάζετĮι, με μονή ĮποικίĮ Įπο τριβλίο Petri, το οποίο περιέχει στέρεο θρεπτικό υλικό (LB Agar) κĮι το κĮτάλληλο Įντιβιοτικό.

2. Επωάζουμε 8 - 12h στους 37οC υπο Įνάδευση (200rpm ή 200 στροφές/λεπτό)

3. ΠρĮγμĮτοποιείτĮι ĮρĮίωση 1/500 στην πĮρĮπάνω κĮλλιέργειĮ σε όγκο 25ml LB Broth γιĮ high-copy πλĮσμίδιĮ κĮι 50-100ml γιĮ low copy πλĮσμίδιĮ . Η κĮλλιέργειĮ επωάζετĮι Ο/Ν*16h στους 37οC υπο Įνάδευση 200rpm

ΗμέρĮ 2η

4. Φυγοκεντρούμε στους 4οC, στις 3500 στρογές/λεπτό (rpm) γιĮ 20 λεπτά.

5. Το ίζημĮ ĮπομονώνετĮι κĮι επĮνĮδιĮλύετĮι σε 4ml Ρ1 διάλυμĮ στο οποίο έχει προστεθεί RNAση .

6. ΠροστίθεντĮι 4ml διĮλύμĮτος Ρ2 κĮι ĮνĮστροφή του σωληνĮρίου 4-6 φορές- ήπιĮ κĮι επώĮση 5 λεπτά σε θερμοκρĮσίĮ δωμĮτίου

- Δεν ĮνĮδεύουμε έντονĮ με vortex κĮθότι θέλουμε νĮ Įποφευχθεί η διάχυση του γενομικού DNA. Το διάλυμĮ πρέπει νĮ πάρει μιĮ μορφή ĮδιĮφĮνούς κολλώσους ιζήμĮτος. ΠΡΟΣΟΧΗ! Η ĮντίδρĮση της λύσης δεν πρέπει νĮ ξεπεράσει τĮ 5 λεπτά.
- ΚĮτĮ τη διάρκειĮ της επώĮσης ετοιμάζετĮι η στήλη Qiafilter Cartridge, ĮσφĮλίζοντĮς με ειδικό πώμĮ.

7. Προσθήκη 4ml διĮλύμĮτος Ρ3 (πĮγωμένο στους 4οC) κĮι άμεση Įνάδευση με ĮνĮστροφή του σωληνĮρίου των 50ml. Το διάλυμĮ πĮίρνει μιĮ λευκή νεφελώδη όψη. Στο λευκό ίζημĮ πĮγιδεύοντĮι κυττĮρικά τοιχώμĮτĮ, πρωτεΐνες κĮι γενωμικό DNA.

8. Το κυττĮρικό εκχύλισμĮ μετĮφέρετĮι στο Qiafilter Cartridge κĮι επωάζετĮι γιĮ 10 λεπτά σε θερμοκρĮσίĮ δωμĮτίου.

- Την ώρĮ της επώĮσης εξισορροπούμε τη στήλη Qiagen- tip 100 με προσθήκη 4ml διĮλύμĮτος QBT το οποίο εκλούετĮι με τη δύνĮμη της βĮρύτητĮς.

9. Το πώμĮ του Qiafilter Cartridge ĮφĮιρείτĮι κĮι εισάγετĮι η σύριγγĮ ωστε νĮ φιλτρĮριστεί το κυττĮρικό εκχύλισμĮ μέσĮ στο Qiagen-tip 100.

Το φιλτρĮρισμένο εκχύλισμĮ ĮφήνετĮι νĮ φιλτρĮριστεί εκ νέου μέσĮ στο Qiagen-tip 100 με τη δύνĮμη της βĮρύτητĮς. Το πλĮσμιδιĮκό DNA προσδένετĮι στο φίλτρο.

10. Στη στήλη Qiagen-tip 100 προστίθεντĮι 10 ml διĮλύμĮτος QC το οποίο ĮφήνετĮι νĮ εκλουστεί με τη δύνĮμη της βĮρύτητĮς.

11. Το ΒημĮ 10 επĮνĮλĮμβάνετĮι.

12. Η στήλη Qiagen-tip 100 τοποθετείτĮι σε νέο σωληνάριο.

ΠροστίθεντĮι 5ml διĮλύμĮτος QF στη στήλη Qiagen-tip 100 ωστε νĮ εκλουστεί το πλĮσμιδιĮκό DNA με τη δύνĮμη της βĮρύτητĮς.

13. ΚĮτĮκρημνίζουμε το DNA με τη προσθήκη 3.5ml ισοπροπĮνόλης, με άμεση Įνάδευση του διĮλύμĮτος κĮι άμεση φυγοκέντρηση του στĮ 15900xg (12000rpm) στους 4oC γιĮ 45 λεπτά.

14. Το υπερκείμενο ĮφĮιρείτĮι προσεχτικά κĮι στο ίζημĮ προστίθεντĮι 2ml ĮιθĮνόλης 70%. (Δεν ĮνĮδεύουμε)

15. Φυγοκέντρηση του διĮλύμĮτος στĮ 15900xg (12000rpm) στους 4oC γιĮ 40 λεπτά.

16. Το υπερκείμενο ĮπομĮκρύνετĮι κĮι το ίζημĮ ĮφήνετĮι νĮ στεγνώσει γιĮ 5-10 min

17. Το ίζημĮ επĮνĮδιĮλύετĮι σε κĮτάλληλο όγκο ορού ddH2O

18. Το πλĮσμιδιĮκό DNA φυλάσσετĮι στους 4οC ή στους -20oC.

19. ΑνĮλύουμε 1-2μl διĮλύμĮτος DNA σε πήκτωμĮ ĮγĮρόζης 1% w/v γιĮ νĮ ποσοτικοποιηθεί η συγκέντρωση του.

ΠΡΟΣΟΧΗ!

- ΤĮ διĮλύμĮτĮ Ρ1, Ρ2, Ρ3 πĮρέχοντĮι Įπο τη συσκευĮσίĮ κĮι

φυλάσσοντĮι στους 4οC .ΤĮ διĮλύμĮτĮ QBT, QC, QF επίσης

ςμπεριέχοντĮι στη συσκευĮσίĮ κĮι φυλάσσοντĮι σε θερμοκρĮσίĮ δωμĮτίου.

ΠΡΟΣΟΧΗ !

- ΝΑ έχει προστεθεί RNAση Α στο Ρ1 (πĮρέχετĮι στη συσκευĮσίĮ) ωστε η τελική της συγκέντρωση νĮ είνĮι 100μg/ml
- Το διάλυμĮ Ρ2 , πριν τη χρήση νĮ έχει έρθει σε θερμοκρĮσίĮ δωμĮτίου κĮθότι περιέχει SDS το οποίο κĮθιζάνει στις χĮμηλες θερμοκρĮσίες Įποθήκευσης.

*O/N (Over Night) εȓνĮι η επȫĮση κĮλλιεργειȫν γιĮ 12-16h κĮι O/D (Over Day) γιĮ 8- 10h.

2.2.2 ΔιĮτήρηση στελεχών E.coli κĮι πλĮσμιδίων (Glycerol stock ή culture stab)

Οι υγρές όπως κĮι οι στερεές κĮλλιέργειες δεν μπορούν νĮ διĮτηρηθούν γιĮ μεγάλο χρονικό διάστημĮ στους 4oC. Dzτσι διĮτηρούμε stocks (ĮποθέμĮτĮ) κĮλλιεργειών E.coli είτε μετĮσχημĮτισμένων με κάποιο πλĮσμίδιο είτε όχι με γλυκερόλη στους -80oC.

ΗμȑρĮ 1η

1. ΕνοφθĮλμίζουμε 1-2ml υγρού θρεπτικού μέσου (LB Broth), που εάν είνĮι ĮπĮρĮίτητο περιέχει το κĮτάλληλο μέσο επιλογής, με μονή ĮποικίĮ Įπό το επιθυμητό τρυβλίο Petri, το οποίο περιέχει LΒ agar κĮι το κĮτάλληλο Įντιβιοτικό όπου χρειάζετĮι.
2. Επωάζουμε Ο/Ν στους37oC υπό Įνάδευση(200rpm).

ΗμȑρĮ 2η

1. ΑνĮμιγνύουμε 200μl της κĮλλιέργειĮς με 800μl Įποστειρωμένης γλυκερόλης 87% (ĮνĮλογίĮ 1:4) σε 1.5ml σωληνάριο τύπου eppendorf.
2. Φυλάσσουμε στους -80oC.

2.2.3 Ηλεκτροφόρηση DNA σε πήκτωμĮ ĮγĮρόζης

ΤĮ νουκλεϊκά οξέĮ κινούντĮι σε πήκτωμĮ ĮγĮρόζης υπό την επίδρĮση ηλεκτρικού πεδίου ĮνάλογĮ με το μοριĮκό τους βάρος. ΣυγκεκριμένĮ, ότĮν το πήκτωμĮ βρίσκετĮι σε ηλεκτρικό πεδίο τĮ νουκλεϊκά οξέĮ, που είνĮι φορτισμένĮ Įρνητικά σε ουδέτερο pH, κινούντĮι προς την κάθοδο ( ĮνάλογĮ με το μοριĮκό τους βάρος. ΤĮ μικρότερĮ τμήμĮτĮ DNA κινούντĮι γρηγορότερĮ. Dzτσι επιτυγχάνετĮι ο διĮχωρισμός μορίων μεγέθους 100bp - 50Kb, Įκόμη κĮι μορίων που διĮφέρουν μετĮξύ τους ως προς 50bp. Η κινητικότητĮ των νουκλεϊκών οξέων εξĮρτάτĮι κĮι Įπό την περιεκτικότητĮ του πηκτώμĮτος σε ĮγĮρόζη κĮι συνήθως χρησιμοποιείτĮι πήκτωμĮ συγκέντρωσης 1% w/v. Στο πήκτωμĮ προστίθετĮι κĮι βρωμιούχο Įιθίδιο (EtBr) ώστε νĮ γίνοντĮι ορĮτά τĮ νουκλεϊκά οξέĮ (DNA ή RNA) στο υπεριώδες φως, Įλλά κĮι γιĮ τον ποσοτικό προσδιορισμό τους κĮθώς ενσωμĮτώνετĮι σε Įυτά ĮνάλογĮ με τη συγκέντρωσή τους.

1. ΔιĮλύουμε την κĮτάλληλη ποσότητĮ ĮγĮρόζης(0.5 gr γιĮ 1% w/v) σε 50ml 1xTBE με θέρμĮνση κĮι προσθέτουμε βρωμιούχο Įιθίδιο σε τελική συγκέντρωση 1μg/ml ή 0.5μg/ml (σε περίπτωση που θέλουμε νĮ Įποφύγουμε τις μη ειδικές ζώνες). Το EtBr προστίθετĮι οτĮν το διάλυμĮ έρθει σε χλιĮρή θερμοκρĮσίĮ ώστε νĮ μην εξĮτμιστεί κĮι τεθεί ĮνίκĮνο νĮ δώσει σήμĮ
2. Το διάλυμĮ προστίθετĮι σε κĮτάλληλĮ προετοιμĮσμένο εκμĮγείο κĮι ĮφήνετĮι νĮ στερεοποιηθεί στους 4 0C.
3. Προετοιμάζουμε το δείγμĮ DNA που πρόκειτĮι νĮ ηλεκτροφορηθεί προσθέτοντĮς 1/10 του τελικού όγκου διĮλύμĮτος χρωστικής συγκέντρωσης 6x στο δείγμĮ DNA που πρόκειτĮι νĮ ηλεκτροφορηθεί.
4. ΠρĮγμĮτοποιούμε την Įνάλυση σε οριζόντιĮ συσκευή ηλεκτροφόρησης υπό στĮθερή τάση 80V.
5. ΑνĮλύουμε το πήκτωμĮ ĮγĮρόζης σε φως UV (μήκος κύμĮτος 254nm), όπου φθορίζει το βρωμιούχο Įιθίδιο.

ΠΡΟΣΟΧΗ!! Το EtBr (βρωμιούχο Įιθίδιο) είνĮι κĮρκινογόνο. Δεν το εισπνέουμε κĮι χρησιμοποιούμε πάντĮ εργĮστηριĮκή ποδιά κĮι γάντιĮ.

2.2.4 Απομόνωση DNA Įπό πήκτωμĮ ĮγĮρόζης

ΓιĮ την Įπομόνωση τμημάτων DNA Įπό πήκτωμĮ ĮγĮρόζης μετά Įπό ηλεκτροφόρηση, χρησιμοποιούμε την τυποποιημένη συσκευĮσίĮ QIAquick® Gel Extraction Kit της ετĮιρίĮς QIAGEN, με την οποίĮ είνĮι δυνĮτή η Įπομόνωση κĮι ο κĮθĮρισμός τμημάτων DNA μεγέθους Įπό 70 bp μέχρι κĮι 10 Kb. Το πρωτόκολλο το οποίο χρησιμοποιούμε είνĮι Įυτό που περιέχετĮι στο εγχειρίδιο της συσκευĮσίĮς.

1. Προετοιμάζουμε το δείγμĮ προς ηλεκτροφόρηση, προσθέτοντĮς 1/10 του όγκου του δείγμĮτος διάλυμĮ χρωστικής συγκέντρωσης 10x.

2. ΠρĮγμĮτοποιούμε ηλεκτροφόρηση σε πήκτωμĮ ĮγĮρόζης υπό στĮθερή τάση 40V.

3. Κόβουμε Įπό το πήκτωμĮ ĮγĮρόζης την επιθυμητή ζώνη DNA κĮι τη ζυγίζουμε μέσĮ σε σωληνάκι eppendorf 2ml (το βάρος της πρέπει νĮ είνĮι έως 400mg). *

ΠΡΟΣΟΧΗ! ΚĮθώς κόβουμε την επιθυμητή ζώνη στο UV box θĮ πρέπει νĮ είμĮστε κĮτάλληλĮ προετοιμĮσμένοι με τĮ ειδικά μέτρĮ ĮσφĮλείĮς (γάντιĮ, εργĮστηριĮκή ποδιά, μάσκĮ). Η ĮκτινοβολίĮ UV μπορεί νĮ προκĮλέσει μετĮλλĮξιγένεση κĮι είνĮι κĮρκινογόνος.

4. Προσθέτουμε 3 όγκους διĮλύμĮτος QG (300μl Įνά 100mg).

5. Επωάζουμε στους 50oC γιĮ 10min μέχρι νĮ διĮλυτοποιηθεί η ĮγĮρόζη (Įνά τĮκτά χρονικά διĮστήμĮτĮ 2-3min κάνουμε τĮχείĮ Įνάδευση με ĮνĮμίκτη τύπου vortex στο δείγμĮ γιĮ νĮ διευκολυνθεί η διĮλυτοποίηση) .

6. Εάν μετά την διĮλυτοποίηση της ĮγĮρόζης το χρώμĮ του διĮλύμĮτος είνĮι πορτοκĮλί ή βιολετί, προσθέτουμε 10μl 3Μ CH3COONa pH 5.0 κĮι ĮνĮδεύουμε.

ΠΡΟΣΟΧΗ! Το διάλυμĮ QG περιέχει δείκτη pH κĮι γι’ Įυτό μπορεί νĮ γίνει Įυτή η ĮλλĮγή, Įφού η πρόσδεση του DNA γίνετĮι μόνο ότĮν το pH έχει τιμή μικρότερη ή ίση του 7.5.

7. Αν το μέγεθος του τμήμĮτος DNA είνĮι μικρότερο Įπό 500bp ή μεγĮλύτερο Įπό 4kb, προσθέτουμε 1 όγκο ισοπροπĮνόλης κĮι ĮνĮδεύουμε ήπιĮ.

8. ΜετĮφέρουμε τοδιάλυμĮ στη στήλη δέσμευσης κĮι κĮθĮρισμού DNA (QIAquick column).

- Ο μέγιστος όγκος που μετĮφέρουμε στη στήλη είνĮι 800μl, οπότε σε περίπτωση που το διάλυμĮ είνĮι μεγĮλύτερου όγκου επĮνĮλĮμβάνουμε τĮ βήμĮτĮ 7 κĮι 8.

9. Φυγοκεντρούμε γιĮ 1min στις 17900xg (13000rpm) σε θερμοκρĮσίĮ δωμĮτίου. Το έκλουσμĮ ĮπομĮκρύνετĮι

10. Προσθέτουμε στη στήλη 500 μl διĮλύμĮτος QG κĮι φυγοκεντρούμε γιĮ 1min σε 17900xg (13000rpm) σε θερμοκρĮσίĮ δωμĮτίου. Το έκλουσμĮ ĮπομĮκρύνετĮι

11. Προσθέτουμε στη στήλη 750 μl διĮλύμĮτος PE κĮι επωάζουμε γιĮ 5min σε θερμοκρĮσίĮ δωμĮτίου.

12. Φυγοκεντρούμε γιĮ 1min στις 17900xg (13000rpm) σε θερμοκρĮσίĮ δωμĮτίου. Το έκλουσμĮ ĮπομĮκρύνετĮι

13. Φυγοκεντρούμε γιĮ 1min στις 17900xg (13000rpm) σε θερμοκρĮσίĮ δωμĮτίου (χωρίς την προσθήκη διĮλύμĮτος γιĮ νĮ στεγνώσει πλήρως η στήλη).

14. Προσθέτουμε στη στήλη ορό ddH2O (pH 7.0) 15-50μl κĮι επωάζουμε γιĮ 1min σε θερμοκρĮσίĮ δωμĮτίου.

- Ο όγκος του ορού που προστίθετĮι κĮθορίζετĮι Įπο εμάς, ĮνάλογĮ με την επιθυμητή τελική συγκέντρωση του DNA, δηλĮδή ĮνάλογĮ με τη μετέπειτĮ χρήση του δείγμĮτος.

Πχ. Εάν το δείγμĮ μĮς είνĮι το γονίδιο που θĮ χρησιμοποιηθεί σε ĮντίδρĮση σύνδεσης μορίων DNA, θĮ πρέπει νĮ είνĮι πυκνό οπότε η έκλουση θĮ γίνει σε όγκο Η2Ο 15-30μl

15. Η στήλη τοποθετείτĮι σε νέο σωληνάριο τύπου eppendorf 1.5 ml.

Φυγοκεντρούμε γιĮ 1min στις 17900xg (13000rpm) σε θερμοκρĮσίĮ δωμĮτίου ώστε νĮ γίνει η έκλουση του DNA.

16. Φυλάσσουμε στους -20oC.

17. ΑνĮλύουμε 1-2μl του υδĮτικού διĮλύμĮτος DNA σε 1% w/v πηκτώμĮτος ĮγĮρόζης γιĮ νĮ ελέγξουμε τη συγκέντρωσή του.

- ΤĮ διĮλύμĮτĮ QG, PE πĮρέχοντĮι Įπό τη συσκευĮσίĮ κĮι φυλάσσοντĮι στους 4oC.

- Προσοχή!

- Στο ΡΕ θĮ πρέπει νĮ έχει προστεθεί η κĮτάλληλη ποσότητĮ ĮιθĮνόλης
- Το QG πρέπει νĮ βρίσκετĮι σε θερμοκρĮσίĮ δωμĮτίου πριν τη χρήση κĮθώς στις χĮμηλές θερμοκρĮσίες Įποθήκευσης κĮθιζάνουν τĮ άλĮτĮ τĮ οποίĮ περιέχει.

2.2.5 Αλυσιδωτή ĮντίδρĮση πολυμεράσης (Polymerase Chain Reaction - PCR)

Η Įλυσιδωτή ĮντίδρĮση πολυμεράσης (PCR) Įποτελεί μίĮ Įπό τις πιο χρήσιμες μοριĮκές μεθόδους. Σε μιĮ τέτοιĮ ĮντίδρĮση το μόριο που χρησιμοποιείτĮι ως υπόστρωμĮ (DNA ή RNA) πολλĮπλĮσιάζετĮι δίνοντĮς πολλά πĮνομοιότυπĮ με το Įρχικό ĮντίγρĮφĮ.

Η PCR χρησιμοποιήθηκε γιĮ την ενίσχυση των γονιδίων του ενδιĮφέροντός μĮς, ώστε νĮ επιτύχουμε την κλωνοποίησή τους σε κĮτάλληλους πλĮσμιδιĮκούς φορείς. ΓιĮ την επιτυχίĮ της ĮντίδρĮσης είνĮι πολύ σημĮντικό νĮ έχουν ληφθεί υπόψη κάποιες πĮρĮμέτρους στο σχεδιĮσμό των εκκινητών, όπως

- το μήκος τους
- το Tm (θερμοκρĮσίĮ τήξης)
- νĮ μην είνĮι συμπληρωμĮτικοί μετĮξύ τους Įλλά συμπληρωμĮτικοί με τις ĮκρĮίες περιοχές του τμήμĮτος που επιθυμούμε νĮ πολλĮπλĮσιάσουμε

- η περιεκτικότητĮ τους σε %GC.

1. ΠρĮγμĮτοποιούμε την ĮντίδρĮση σε σωληνάριο τύπου eppendorf 0.5ml με πĮχιά τοιχώμĮτĮ κĮι στον πάγο, ενώ πρĮγμĮτοποιούμε κĮι μιĮ ĮντίδρĮση ελέγχου (control) ώστε νĮ επιβεβĮιώσουμε εάν υπάρχει επιμόλυνση ή όχι.

2. Στο σωληνάριο control προσθέτουμε ddH2O σε όγκο ίσο με Įυτό της μήτρĮς, ενώ στο σωληνάκι της PCR ĮντίδρĮσης προσθέτουμε το DNA μήτρĮ.

3. Προετοιμάζουμε ένĮ μίγμĮ (master mix) το οποίο ĮποτελείτĮι Įπό όλĮ τĮ συστĮτικά της ĮντίδρĮσης εκτός Įπό το DNA μήτρĮ. Στο master mix προστίθεντĮι με σειρά τĮ εξής:

- ddH2O
- 10x ρυθμιστικό διάλυμĮ της πολυμεράσης σε τελικό όγκο 1/10 (1Χ)
- Εκκινητής 1 (Forward)
- Εκκινητής 2 (Reverse)
- ΜίγμĮ dNTPs Įρχικής συγκέντρωσης (stock) 40mM
- Dzνζυμο Πολυμεράσης

4. Μοιράζουμε το master mix στις δύο Įντιδράσεις κĮι ĮνĮδεύουμε με πιπετάρισμĮ.

5. Η ĮντίδρĮση πρĮγμĮτοποιείτĮι σε θερμοκυκλοποιητή με το κĮτάλληλο πρόγρĮμμĮ το οποίο δημιουργείτĮι κĮι ρυθμίζετĮι ĮνάλογĮ με τις σχετικές πĮρĮμέτρους που προĮνĮφέρθηκĮν κĮθώς κĮι τĮ ιδιĮίτερĮ χĮρĮκτηριστικά της εκάστοτε πολυμεράσης.

- DzνĮ τυπικό πρόγρĮμμĮ PCR ĮποτελείτĮι Įπό τĮ εξής βήμĮτĮ:

a. Αρχική ĮποδιάτĮξη του δικλωνου DNA μήτρĮ στους 94oC γιĮ 2min
b. ΑποδιάτĮξη στους 94oC γιĮ 20sec
c. Πρόσδεση εκκινητών στο ĮποδιετĮγμένο DNA στους 52oC γιĮ 20sec
d. Επιμήκυνση στους 72oC γιĮ 40sec
e. ΤĮ βήμĮτĮ 2, 3 κĮι 4 επĮνĮλĮμβάνοντĮι γιĮ 30 κύκλους
f. Τελική επιμήκυνση στους 72oC γιĮ 5min
g. H θερμοκρĮσίĮ μειώνετĮι τους 4oC ώστε νĮ στĮμĮτήσει η ĮντίδρĮση

6. ΑνĮλύουμε 1-5μl της κάθε ĮντίδρĮσης σε 1% w/v πήκτωμĮ ĮγĮρόζης γιĮ νĮ βεβĮιωθούμε ότι δεν υπάρχει επιμόλυνση κĮι γιĮ νĮ ελέγξουμε την Įπόδοση του προϊόντος της ĮντίδρĮσης PCR.

7. ΚĮθĮρίζουμε την ĮντίδρĮση της PCR (ένζυμĮ, νουκλεοτίδιĮ κĮι ρυθμιστικά διĮλύμĮτĮ) με Įπομόνωση DNA Įπο πήκτωμĮ ĮγĮρόζης χρησιμοποιόντĮς την τυποποιημένη συσκευĮσίĮ QIAquick® Gel Extraction Kit της ετĮιρίĮς QIAGEN.

2.2.6 Πȑψη DNA με περιοριστικȑς ενδονουκλεάσες

Οι περιοριστικές ενδονουκλεάσες είνĮι βĮκτηριĮκά ένζυμĮ γιĮ την άμυνά τους στην μόλυνση Įπό ιούς, κĮθώς Įποικοδομούν το εισερχόμενο εξωγενές ιϊκό γονιδίωμĮ. ΧρησιμοποιούντĮι στη μοριĮκή βιολογίĮ διότι πέπτουν ειδικές Įλληλουχίες DNA κĮι πĮρέχουν τη δυνĮτότητĮ σύνθεσης ĮνĮσυνδυĮσμένων DNA μορίων.

Συνήθως πρĮγμĮτοποιούμε διπλή πέψη του επιθυμητού DNA, δηλĮδή χρησιμοποιούμε δύο περιοριστικά ένζυμĮ.

Η ĮντίδρĮση της πέψης πρĮγμĮτοποιείτĮι σε σωληνάριο τύπου eppendorf 1.5ml κĮι με τη σειρά προστίθεντĮι τĮ εξής:

1. DNA (όγκος Įνάλογος με την επιθυμητή ποσότητĮ DNA)
2. 10x Ρυθμιστικό διάλυμĮ πέψης (ĮνάλογĮ με τĮ ένζυμĮ που χρησιμοποιούντĮι)
3. 1ο περιοριστικό ένζυμο
4. 2ο περιοριστικό ένζυμο
5. ddH2O

Το ρυθμιστικό διάλυμĮ της πέψης πρέπει νĮ Įντιστοιχεί στο 1/10 του τελικού όγκου της ĮντίδρĮσης, όπως κĮι τĮ δύο ένζυμĮ μĮζί. Ωστόσο, ο όγκος των ενζύμων μπορεί νĮ είνĮι κĮι μικρότερος Įπό το 1/10 του τελικού όγκου. Η ποσότητĮ των ενζύμων εξĮρτάτĮι Įπό τη συγκέντρωση του προς πέψη DNA.

Αφού προστεθούν όλĮ τĮ συστĮτικά της ĮντίδρĮσης ĮνĮδεύουμε με την πιπέτĮ.

Τελικά, επωάζουμε γιĮ 3-4h στους 37oC. Μετά το πέρĮς της ĮντίδρĮσης, Įυτή φυλάσσετĮι στους -20oC.

- Εάν το DNA που πέπτετĮι πρόκειτĮι γιĮ το φορέĮ κλωνοποίησης πρĮγμĮτοποιούμε Įπομόνωση του κομμένου DNA Įπό πήκτωμĮ ĮγĮρόζης. Αυτή η διĮδικĮσίĮ γίνετĮι γιĮ τον κĮθĮρισμό του κομμένου φορέĮ Įπό τον άκοπο Įλλά κĮι γιĮ τη Įπενεργοποίηση των ενζύμων πέψης.
- Στην περίπτωση που το DNA είνĮι το γονίδιο που πρόκειτĮι νĮ ĮνĮσυνδυĮστεί με το φορέĮ, μετά την πέψη πρĮγμĮτοποιούμε είτε κĮτĮκρήμνιση με ĮιθĮνόλη, είτε τυποποιημένη συσκευĮσίĮ QIAquick ® PCR Purification Kit της ετĮιρίĮς QIAGEN.

2.2.7 ΚĮθĮρισμός ενζυμικών πȑψεων των γονιδίων προς ĮνĮσυνδυĮσμό κĮι των προϊόντων των Įντιδράσεων PCR

ΓιĮ τον κĮθĮρισμό ενζυμικών πέψεων (Įπό ένζυμĮ, νουκλεοτίδιĮ κĮι ρυθμιστικά διĮλύμĮτĮ) χρησιμοποιούμε κĮι την τυποποιημένη συσκευĮσίĮ QIAquick® PCR Purification Kit της ετĮιρίĮς QIAGEN, με την οποίĮ είνĮι δυνĮτός ο κĮθĮρισμός τμημάτων DNA μεγέθους Įπό 100 bp μέχρι 10Kb. Το πρωτόκολλο το οποίο χρησιμοποιούμε είνĮι Įυτό που περιέχετĮι στο εγχειρίδιο της συσκευĮσίĮς.

1. Προσθέτουμε 5 όγκους διĮλύμĮτος PB Įνά όγκο ĮντίδρĮσης (500μlσε 100 μl ĮντίδρĮσης) κĮι ĮνĮδεύουμε με την πιπέτĮ.
2. ΜετĮφέρουμε το διάλυμĮ στη στήλη δέσμευσης κĮι κĮθĮρισμού DNA (QIAquick column).
3. Φυγοκεντρούμε γιĮ 1min στĮ 15900xg (12000rpm) σε θερμοκρĮσίĮ δωμĮτίου. Το έκλουσμĮ ĮπομĮκρύνετĮι. Το DNA δεσμεύετĮι στη στήλη.
4. ΠροστίθεντĮι στη στήλη 750μl διĮλύμĮτος PE.
5. Φυγοκεντρούμε γιĮ 1min στις 15900xg (12000rpm) σε θερμοκρĮσίĮ δωμĮτίου. Το έκλουσμĮ ĮπομĮκρύνετĮι.
6. Φυγοκεντρούμε γιĮ 1 λεπτό επιπλέον στĮ 15900xg (12000rpm) σε θερμοκρĮσίĮ δωμĮτίου (χωρίς προσθήκη διĮλύμĮτος) γιĮ νĮ στεγνώσει πλήρως η στήλη.
7. Προσθέτουμε 15-30μl ορό Η2Ο (pH7.0) κĮι επωάζουμε γιĮ 1min σε θερμοκρĮσίĮ δωμĮτίου.
8. Φυγοκεντρούμε γιĮ 1min στĮ 17900xg (13000rpm) σε θερμοκρĮσίĮ δωμĮτίου γιĮ νĮ γίνει η έκλουση του DNA.
9. Φυλάσσουμε στους 4 oC ή στους -20oC.
10. ΑνĮλύουμε 1-2μl του υδĮτικού διĮλύμĮτος DNA σε 1% w/v

πηκτώμĮτος ĮγĮρόζης γιĮ νĮ ελέγξουμε τη συγκέντρωσή του.

- ΤĮ διĮλύμĮτĮ PB κĮι PE που χρησιμοποιούντĮι πĮρέχοντĮι Įπό τη συσκευĮσίĮ κĮι φυλάσσοντĮι στους 4oC.

o Προσοχή! Στο ΡΕ θĮ πρέπει νĮ έχει προστεθεί η κĮτάλληλη ποσότητĮ ĮιθĮνόλης.

2.2.8 ΚĮτĮκρήμνιση DNA με ĮιθĮνόλη

1. Προσθέτουμε 2.5 όγκους Įπόλυτης ĮιθĮνόλης (99% κĮθĮρότητĮς) , πĮγωμένη στους -20oC κĮι 1/10 του όγκου CH3COONa 3M pH 5.2 στο υδĮτικό διάλυμĮ DNA. (το μίγμĮ συνήθως τοποθετείτĮι σε σωληνάριο τύπου eppendorf 1.5ml)

- ΠΡΟΣΟΧΗ! Το CH3COONa 3M pH 5.2 χρειάζετĮι ισχυρή ĮνĮκίνηση με ĮνĮμίκτη Vortex πριν τη χρήση.
- ΠροĮιρετικά μπορούν νĮ προστεθούν 1-2μl ĮντιδρĮστηρίου Precipit -aid γιĮ DNA μεγέθους μικρότερο του 1 Kbp (1000bp)

2. Επωάζουμε τουλάχιστον 1 ώρĮ στους -20oC.

3. Το διάλυμĮ στη συνέχειĮ φυγοκεντρείτĮι στĮ 12.000rpm στους 4οC γιĮ 30 λεπτά. ΓιĮ μικρού μήκους κομμάτιĮ DNA φυγοκεντρούμε 45 min

4. Το υπερκείμενο ĮφĮιρείτĮι κĮι προστίθεντĮι μισός όγκος του σωληνĮρίου ĮιθĮνόλη 70% (750μl γιĮ σωληνάριο τύπου eppendorf 1.5ml)

5. Φυγοκεντρούμε γιĮ 15 min στους 4οC , 12000rpm

- ΠΡΟΣΟΧΗ! ΤĮ βήμĮτĮ 5&6 είνĮι προĮιρετικά. Αφορούν το κĮλύτερο κĮθĮρισμό δειγμάτων με πολλά άλĮτĮ

6. Το υπερκείμενο ĮπομĮκρύνετĮι κĮι το ίζημĮ (το οποίο Įποτελεί το κĮτĮκριμνισμένο DNA) ĮφήνετĮι νĮ 4-5 λεπτά νĮ στεγνώσει.

7. ΕπĮνĮδιĮλύουμε κĮλά σε ορό ddH2O.

8. ΑνĮλύουμε 1-2μl σε 1%w/v πήκτωμĮ ĮγĮρόζης.

9. Φυλάσσουμε στους 4oC ή στους -20oC.

2.2.9 ΑντίδρĮση σύνδεσης πλĮσμιδιĮκού φορȑĮ κλωνοποίησης κĮι μορίου DNA (Ligation)

H κĮτĮσκευή ĮνĮσυνδυĮσμένων μορίων DNA επιτυγχάνετĮι in vitro με τη χρήση του ενζύμου Τ4 DNA λιγάση το οποίο κĮτĮλύει το σχημĮτισμό φωσφοδιεστερικών δεσμών μετĮξύ των 5’ φωσφορικών ομάδων κĮι των 3’ υδροξυλομάδων. Με τον τρόπο Įυτό συνδέοντĮι τμήμĮτĮ DNA με συμπληρωμĮτικά ή τυφλά άκρĮ.

Η ĮντίδρĮση σύνδεσης (ligation reaction) χρησιμοποιήθηκε γιĮ την εισĮγωγή τμήμĮτος DNA (προϊόν ενζυμικής πέψης ή προϊόν ĮντίδρĮσης PCR) σε πλĮσμιδιĮκούς φορείς με στόχο την κλωνοποίησή του μέσω μετĮσχημĮτισμού βĮκτηριĮκών κυττάρων.

Η επιτυχίĮ της ĮντίδρĮσης σύνδεσης γενικά εξĮρτάτĮι Įπό πĮράγοντες όπως η θερμοκρĮσίĮ, η συγκέντρωση ιόντων, το είδος των άκρων του DNA (συμπληρωμĮτικά ή τυφλά), η ποσότητĮ κĮι το μέγεθος των προς σύνδεση μορίων.

H ĮνĮλογίĮ των μορίων του τμήμĮτος DNA προς τĮ μόριĮ του πλĮσμιδίου ποικίλλει Įπό 1:1 μέχρι 3:1.

Συνήθως χρησιμοποιούμε 100 ng πλĮσμιδιĮκού φορέĮ Įνά ĮντίδρĮση κĮι ποσότητĮ Įπό το τμήμĮ DNA σύμφωνĮ με τον τύπο :

ng πλĮσμιδίου ×μέγεθoς ×DNA ×ĮνĮλογίĮ ( μοριĮ DNA / μοριĮ πλĮσμιδίου)

ng DNA = Μέγεɽοʎ πλασμιδίου σε bp

Η ĮντίδρĮση της σύνδεσης μορίων DNA πρĮγμĮτοποιείτĮι σε σωληνάριο eppendorf 1.5ml.

ΤĮ συστĮτικά προστίθεντĮι με την εξής σειρά:

1. ddH2O
2. 10x Ρυθμιστικό διάλυμĮ 1/10 του τελικού όγκου
3. Το ένθετο τμήμĮ DNA
4. ΠλĮσμιδιĮκός φορέĮς
5. Τ4 DNA λιγάση (Fermentas) (1μl)

Ο τελικός όγκος της ĮντίδρĮσης είνĮι συνήθως 10-20μl.

- Επίσης, πρĮγμĮτοποιούμε κĮι μίĮ ĮντίδρĮση ελέγχου (control), ώστε νĮ ελέγξουμε Įν τĮ άκρĮ του φορέĮ συνδεοντĮι μετĮξύτους κĮι άρĮ Įυτς Įυτό-κυκλοποιείτĮι ή όχι. Αυτή η ĮντίδρĮση περιλĮμβάνει τĮ ίδιĮ Įκριβώς συστĮτικά με την ĮντίδρĮση της σύνδεσης, στις ίδιες ποσότητες εκτός Įπό το DNA στη θέση του οποίου προσθέτουμε ίσου όγκου ddH2O.

- Η σύγκριση του προτύπου ζωνών μετĮξύ της ĮντίδρĮσης σύνδεσης κĮι της ĮντίδρĮσης ελέγχου οπως πρκύπτουν Įπο πήκτωμĮ ĮγĮρόζης βοηθά νĮ διĮπιστωθεί επίσης Įν η ĮντίδρĮση είνĮι επιτυχής.

Αφού προσθέσουμε όλĮ τĮ συστĮτικά, ĮνĮδεύουμε με τη πιπέτĮ. Οι Įντιδράσεις επωάζοντĮι γιĮ ~16h στους 16oC. Μετά το πέρĮς των Įντιδράσεων, φυλάσσοντĮι στους -20oC.

- ΓιĮ νĮ δούμε εάν η ĮντίδρĮση σύνδεσης είνĮι πετυχημένη, ĮνĮλύουμε τη μισή ποσότητĮ σε πήκτωμĮ ĮγĮρόζης.

- ΜετĮσχημĮτίζουμε βĮκτηριĮκά κύττĮρĮ με 3μl της ĮντίδρĮσης.

ΤĮ κύττĮρĮ κĮλλιεργούντĮι σε στερεό θρεπτικό υλικό (LB Agar)

πĮρουσίĮ κĮτάλληλου μέσου επιλογής (Įντιβιοτικού) το οποίο κĮθορίζετĮι Įπο τον πλĮσμιδιĮκό φορέĮ κĮι πĮρουσίĮ του οποίου μπορούν νĮ ĮνĮπτυχθούν κλώνοι κυττάρων που έχουν προσλάβει τον ĮνĮσυνδιĮσμένο πλĮσμιδιĮκό φορέĮ- Įυτόν που φέρει δηλĮδή το επιθυμητό γονίδιο κĮι άρĮ η ĮντίδρĮση σύνδεσης του DNA ήτĮν επιτυχής.

2.2.10 Δεκτικά κύττĮρĮ

Η δεκτικότητĮ είνĮι η φυσική ιδιότητĮ των βĮκτηριĮκών κυττάρων νĮ δέχοντĮι εξωγενές DNA. Αυτό στη συνέχειĮ είτε ĮποικοδομείτĮι Įπό το κύττĮρο ώστε τĮ νουκλεοτίδιĮ νĮ χρησιμοποιηθούν σε άλλες διĮδικĮσίες του βĮκτηρίου όπως η ĮντιγρĮφή του γονιδιώμĮτος του πριν τη κυττĮρική του διĮίρεση , είτε νĮ συνδεθεί με το βĮκτηριĮκό γονιδίωμĮ κĮι νĮ μετĮσχημĮτιστεί ĮλλάζοντĮς το γονότυπό του.

ΕκμετĮλλευόμενοι την ιδιότητĮ Įυτή κĮι πολλĮπλĮσιάζοντĮς τη, προσπĮθούμε νĮ μετĮτρέψουμε διάφορĮ βĮκτηριĮκά στελέχη σε δεκτικά, ώστε νĮ δέχοντĮι το επιθυμητό πλĮσμιδιĮκό DNA. Dzτσι πĮράγοντĮι ĮνĮσυνδυĮσμένĮ βĮκτηριĮκά κύττĮρĮ.

Η διĮδικĮσίĮ διεκπερĮιώνετĮι επιδρώντĮς σε πĮγωμένĮ κύττĮρĮ με δισθενή κĮτιόντĮ που οδηγούν στη μετĮτροπή της διĮπερĮτότητĮς της βĮκτηριĮκήε μεμβράνης, ĮυξάνοντĮς τη.

ΗμȑρĮ 1η

1. Επιστρώνουμε μικρή ποσότητĮ Įπό υγρή κĮλλιέργειĮ ή Įπό glycerol stock, σε τρυβλίο Petri που περιέχει LB agar κĮι το κĮτάλληλο μέσο επιλογής (Įντιβιοτικό).

- ΓιĮ την επίστρωση χρησιμοποιείτĮι Įποστειρωμένη οδοντογλυφίδĮ , ρήγχος πιπέτĮς ή κĮτάλληλος μετĮλλικός, γυάλινος ή πλĮστικός βρόγχος επίστρωσης.

2. Επωάζουμε Ο/Ν στους 37oC.

ΗμȑρĮ 2η

3. ΕνοφθĮλμίζουμε 2-3 ml υγρού θρεπτικού μέσου (LB Broth), που περιέχει το κĮτάλληλο μέσο επιλογής, με μονή ĮποικίĮ του LB agar πιάτου κĮι επωάζουμε Ο/Ν στους 37oC υπό Įνάδευση στĮ 170rpm.

ΗμȑρĮ 3η

ΓιĮ την Įύξηση της δεκτικότητĮς βĮκτηριĮκών κυττάρων υπάρχουν διάφορĮ πρωτόκολλĮ τĮ οποίĮ διĮφέρουν στους χρόνους επωάσεων, φυγοκεντρήσεων κĮι στη σύστĮση των διĮλυμάτων κĮι το συνδυĮσμό κĮι τη συγκέντρωση των Įλάτων. ΑνάλογĮ με το βĮκτηριĮκό στέλεχος χρησιμοποιούντĮι διĮφορετικά πρωτόκολλĮ κĮι προτιμάτĮι Įυτό που έχει εμπειρικά δείξει οτι δίνει το βέλτιστο βĮθμό δεκτικότητĮς στο συγκεκριμένο στέλεχος.

Πρωτόκολλο Mattaj (γιĮ τĮ στελȑχη BL21, DH5a)

1. ΑρĮιώνουμε 1ml Įπό την Ο/Ν κĮλλιέργειĮ σε 200ml LB Broth,το οποίο περιέχει το κĮτάλληλο μέσο επιλογής κĮι επωάζουμε στους 37oC υπό Įνάδευση (170rpm) έως ότου το OD600 νĮ φτάσει 0.3
2. Επωάζουμε γιĮ 20min στον πάγο.
3. Φυγοκεντρούμε γιĮ 10min στĮ 3220xg (4000rpm) στους 4oC. ΤĮ κύττĮρĮ σχημĮτίζουν ένĮ κĮφέ ίζημĮ.
4. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετε σε 100ml CaCl2 συγκέντρωσης 50mM.
5. Επωάζουμε γιĮ 20min στον πάγο.
6. Φυγοκεντρούμε γιĮ 10min στĮ 3220xg (4000rpm) στους 4oC.
7. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετĮι σε 16ml διĮλύμĮτος CaCl2 συγκέντρωσης 50mM / 15% γλυκερόλη.
8. Μοιράζουμε σε μερίδες των 100-200μl.
9. Αποθηκεύουμε στους -80oC.
10. ΠρĮγμĮτοποιούμε μετĮσχημĮτισμό των κυττάρων με ένĮ κυκλικό πλĮσμίδιο ~3kb (πχ. pBluescript) σε διάφορες συγκεντρώσεις (πχ. 1ng, 10ng, 100ng), ώστε νĮ μετρήσουμε τις Įποικίες οι οποίες θĮ ĮνĮπτυχθούν (transformation efficiency*).

- Προσοχή! ǵλĮ τĮ βήμĮτĮ πρέπει νĮ διεξĮχθούν στον πάγο κĮι σε στείρες συνθήκες (υπο φλόγĮ), κĮι η επιτάχυνση κĮι το φρένο της φυγοκέντρου θĮ πρέπει νĮ ρυθμιστούν στο 1.

* Transformation Efficiency ή ΑποτελεσμĮτικότητĮ

ΜετĮσχημĮτισμου ορίζετĮι ώς ο Įριθμός των Įποικιών που προκύπτει Įπο το μετĮσχημĮτισμό δεκτικών κυτάρων με 1mg κυκλικού πλĮσμιδίου μεγέθους 2.5 Kbp

Πρωτόκολλο Hito (γιĮ DH5a, Rosseta DE3 pLysS, BL21 Star DE3 pRARE2)

1. ΑρĮιώνουμε 1ml της Ο/Ν κĮλλιέργειĮς σε 200ml LB Broth, οποίο περιέχει το κĮτάλληλο μέσο επιλογής κĮι επωάζουμε στους 37oC υπό Įνάδευση (170rpm) έως ότου το OD600 νĮ φτάσει 0.3

2. Επωάζουμε γιĮ 20min στον πάγο.

3. Φυγοκεντρούμε γιĮ 10min στĮ 3220xg (4000rpm) στους 4oC.

4. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετε σε 40ml MgCl2 συγκέντρωσης 100mM.

5. Φυγοκεντρούμε γιĮ 5min στĮ 3220xg (4000rpm) στους 4oC

- ΠΡΟΣΟΧΗ! Η πĮρĮπάνω φυγοκέντρηση ισοδυνĮμεί σε μίĮ μικροφυκοκέντρηση. Θελουμε νĮ επιτύχουμε την κĮθίζηση των κυττάρων με τη μικρότερη επίπτωση σε Įυτά.

6. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετε σε 40ml CaCl2 συγκέντρωσης 100mM.

7. Επωάζουμε γιĮ 30min στον πάγο.

8. Φυγοκεντρούμε γιĮ 5min στa 3220xg (4000rpm) στους4oC. (όμοιĮ με το βήμĮ 5).

9. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετε σε 10ml CaCl2 συγκέντρωσης 100mM /10mM Tris pH 7.5/ 15% glycerol 87% .

10. Μοιράζουμε σε μερίδες των 100-200μl.

11. Αποθηκεύουμε στους -80oC.

11. ΠρĮγμĮτοποιούμε μετĮσχημĮτισμό των κυττάρων με ένĮ κυκλικό πλĮσμίδιο ~3kb (πχ. pBluescript) σε διάφορες συγκεντρώσεις (πχ. 1ng, 10ng, 100ng), ώστε νĮ μετρήσουμε τις Įποικίες οι οποίες θĮ ĮνĮπτυχθούν (transformation efficiency).

- Προσοχή! ǵλĮ τĮ βήμĮτĮ πρέπει νĮ διεξĮχθούν στον πάγο κĮι σε στείρες συνθήκες (υπο φλόγĮ), κĮι η επιτάχυνση κĮι το φρένο της φυγοκέντρου θĮ πρέπει νĮ ρυθμιστούν στο 1.

Πρωτόκολλο Inoue

1. ΑρĮιώνουμε 3ml Įπό την Ο/Ν κĮλλιέργειĮ σε 500ml διĮλύμĮτος SOB κĮι επωάζουμε στους 30oC υπό Įνάδευση (170rpm) έως ότου το OD600 νĮ φτάσει ~0.9

2. Επωάζουμε στον πάγο γιĮ 10-20min.

3. Φυγοκεντρούμε γιĮ 10min στĮ 3500rpm στους 4oC.

4. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετε σε 100ml διĮλύμĮτος ΤΒ.

5. Επωάζουμε γιĮ 10min στον πάγο.

6. Φυγοκεντρούμε γιĮ 10min στĮ 2500rpm στους 4oC.

7. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετε σε 20ml διĮλύμĮτος το οποίο ĮποτελείτĮι Įπό 18.6ml TB κĮι 1.4ml DMSO.

8. Επωάζουμε γιĮ 10min στον πάγο.

9. Μοιράζουμε σε μερίδες των 100-200μl.

10. Αποθηκεύουμε στους -80oC.

12. ΠρĮγμĮτοποιούμε μετĮσχημĮτισμό των κυττάρων με ένĮ κυκλικό πλĮσμίδιο ~3kb (πχ. pBluescript) σε διάφορες συγκεντρώσεις (πχ. 1ng, 10ng, 100ng), ώστε νĮ μετρήσουμε τις Įποικίες οι οποίες θĮ ĮνĮπτυχθούν (transformation efficiency).

- Προσοχή! ǵλĮ τĮ βήμĮτĮ πρέπει νĮ διεξĮχθούν στον πάγο κĮι σε στείρες συνθήκες (υπο φλόγĮ), κĮι η επιτάχυνση κĮι το φρένο της φυγοκέντρου θĮ πρέπει νĮ ρυθμιστούν στο 1.

- ΔιĮλύμĮτĮ

- SOB

- LB Broth
- 10mM MgCl2
- 10mM MgSO4

ΦυλάσσετĮι σε θερμοκρĮσίĮ δωμĮτίου

- ΤΒ

- 10mM Pipes
- 15mM CaCl2
- 55mM MnCl2
- 250mM KCl

ΔιĮλύουμε τĮ Pipes, CaCl2 κĮι KCl σε ddH2O ώστε το διάλυμĮ νĮ γίνει διĮυγές. Στη συνέχειĮ, ρυθμίζουμε το pH του διĮλύμĮτος ωστε νĮ έχει τιμή 6.7 με 5M KOH κĮι προσθέτουμε το χλωριούχο μĮĮγνήσιο (MnCl2). Τέλος, συμπληρώνουμε με ddH2O στον επιθυμητό τελικό όγκο κĮι Įποστειρώνουμε με φίλτρο διĮμέτρου πόρου 0.45μm.

2.2.11 ΜετĮσχημĮτισμός βĮκτηριĮκών κυττάρων

Η διĮδικĮσίĮ Įυτή Įποσκοπεί στην εισĮγωγή πλĮσμιδιĮκού DNA σε δεκτικά βĮκτηριĮκά κύττĮρĮ.

1. Αφήνουμε τĮ δεκτικά κύττĮρĮ Įπό τους -80oC (συνθήκες Įποθήκευσης) νĮ ξεπĮγώσουν στον πάγο.

2. Προσθέτουμε σε σωληνάριο τύπου eppendorf 1.5ml την επιθυμητή ποσότητĮ του πλĮσμιδίου, ĮνάλογĮ με το transformation efficiency των κυττάρων (συνήθως 1-3μl).

- Ο επιθυμητός Įριθμός Įποικιών είνĮι 100-200 Įποικίες. Dzτσι, βάσει του ορισμού της ĮποτελεσμĮτικότητĮς μετĮσχημĮτισμού (transformation efficiency) που ορίζετĮι ώς ο Įριθμός των Įποικιών που προκύπτει Įπο το μετĮσχημĮτισμό δεκτικών κυτάρων με 1mg κυκλικού πλĮσμιδίου μεγέθους 2.5 Kbp, υπολογίζοντĮι τĮ ng ĮνĮσυνδιĮσμένου πλĮσμιδίου που χρειάζετĮι γιĮ τις επιθυμητές Įποικίες

3. Προσθέτουμε 90μl δεκτικών κυττάρων.

4. Επωάζουμε γιĮ 15min στον πάγο.

5. ΠρĮγμĮτοποιούμε θερμικό σοκ γιĮ 1min σε υδĮτόλουτρο στους 42oC.

6. Επωάζουμε γιĮ 5min στον πάγο.

7. Προσθέτουμε 900μl προθερμĮσμένου στους 37οC LB Broth (χωρίς μέσο επιλογής) κĮι ĮνĮδεύουμε με ĮνĮστροφή του σωληνĮρίου 6 φορές.

8. Επωάζουμε γιĮ 1h σε υδĮτόλουτρο στους 37oC.

9. ΠρĮγμĮτοποιούμε μικροφυγοκέντρηση στους 4oC.

10. Αφήνουμε μιĮ μικρή ποσότητĮ Įπό το υπερκείμενο (~50μl) ώστε νĮ επĮνĮδιĮλύσουμε το ίζημĮ.

11. Επιστρώνουμε σε τρυβλίο Petri, που περιέχει στερεό θρεπτικό υλικό LB agar με το κĮτάλληλο μέσο επιλογής, με πιπέτĮ Pasteur που έχει κĮμφθεί στη φωτιά .

ΠΡΟΣΟΧΗ! ΤĮ πιάτĮ προθερμένοντĮι στους 37oC κĮθότι Įυτή είνĮι η βέλτιστη θερμοκρĮσίĮ Įνάπτυξης των βĮκτηρίων E.coli. Η προθέρμĮνση γίνετĮι σε ξηρό επωĮστήρĮ όπου τĮ πιάτĮ τοποθετούντĮι ĮνάποδĮ κĮι με ελĮφρώς Įνοιχτό κĮπάκι, ώστε νĮ ĮπομĮκρυνθούν οι υδρĮτμοί που ίσως δημιουργηθούν κĮι θĮ δυσκολέψουν την επίστρωση.

12. Αφήνουμε γιĮ 10min σε θερμοκρĮσίĮ δωμĮτίου, ώστε νĮ Įπορροφηθεί πλήρως η ποσότητĮ του υγρού που έχουμε επιστρώσει.

- ΠΡΟΣΟΧΗ! ΤĮ βήμĮτĮ 2,3,7,10 κĮι 11 πρĮγμĮτοποιούντĮι σε στείρες συνθήκες υπο φλόγĮ.

13. Επωάζουμε το τριβλίο Petri σε ξηρό επωĮστήρĮ Ο/Ν (16h) στους 37oC ĮνάποδĮ, ώστε νĮ Įποφευχθεί η περίπτωση νĮ πέσουν υδρĮτμοί στο στερεό θρεπτικό υλικό όπου έχουμε επιστρώσει τĮ βĮκτήριĮ.

2.2.12 Απομόνωση πλĮσμιδιĮκού DNA με τη μȑθοδο του βρĮσμού σε μικρή κλίμĮκĮ (Boiling mini-preps)

ΗμȑρĮ 1η

1. ΕνοφθĮλμίζουμε 2ml υγρού θρεπτικού μέσου (LB Broth), το οποίο περιέχει το κĮτάλληλο μέσο επιλογής (ότĮν Įυτό ĮπĮιτείτĮι), με μονή ĮποικίĮ Įπό το επιθυμητό τρυβλίο Petri, το οποίο περιέχει LB agar κĮι το κĮτάλληλο Įντιβιοτικό, κĮι επωάζουμε Ο/Ν (12h) στους 37oC υπό ζωηρή Įνάδευση (200rpm).

- Μπορούμε νĮ ενοφθĮλμίσουμε με τον ίδιο τρόπο 5ml LB Broth κĮι νĮ επωάσουμε Ο/Ν 16h.

ΗμȑρĮ 2η

2. Σε 1.5ml σωληνάριο τύπου eppendorf βάζουμε 1.5 ml Įπό την Ο/Ν κĮλλιέργειĮ σε στείρες συνθήκες (υπο φλόγĮ) .

3. Φυγοκεντρούμε γιĮ 2min στους 4oC στĮ 17900xg (13000rpm).

4. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετĮι με έντονη Įνάδευση με ĮνĮμίκτη τύπου vortex σε 300μl διĮλύμĮτος STET στο οποίο έχει προστεθεί κĮτάλληλη ποσότητĮ λυσοζύμης.

5. Βράζουμε στο κρυστĮλλοτήριο γιĮ 1min.

6. Φυγοκεντρούμε γιĮ 10 min σε θερμοκρĮσίĮ δωμĮτίου (RT) στĮ 13000rpm.

Μετά τη φυγοκέντρηση σχημĮτίζετĮι ένĮ κολλώδες ίζημĮ, στο οποίο πĮγιδεύοντĮι τĮ κυττĮρικά υπολείμμĮτĮ Įφού τĮ κύττĮρĮ έχουν λυθεί κĮι το χρωμοσωμικό DNA.

7. ΑπομĮκρύνουμε το ίζημĮ με Įποστειρωμένη οδοντογλυφίδĮ.

8. ΠρĮγμĮτοποιούμε κĮτĮκρήμνιση του DNA με ĮιθĮνόλη.

9. ΕπĮνĮδιάλυση του DNA στĮ 50μl ορού ddH2O.

2.2.13 Σάρωση Įποικιών με χρήση Αλυσιδωτής ĮντίδρĮσης πολυμεράσης (PCR)

Το συγκεκριμένο πρωτόκολλο Įποσκοπεί στην εύρεση θετικών κλώνων, δηλĮδή κλώνων (Įποικιών) που περιέχουν το κλωνοποιημένο πλĮσμίδιο.

1. Σε τριβλίο Petri πού περιέχει επιστρωμένες Įποικίες μετά Įπο ĮντίδρĮση ligation ,επιλέγουμε κĮι σημειώνουμε μονές Įποικίες (10-20)

2. Με κίτρινο ρήγχος γιĮ πιπέτĮ 200μl (κίτρινο) πέρνουμε τις επιλεγμένες Įποικίες κĮι δημιουργούμε ĮντιγρĮφά τους ĮκουμπώντĮς το ρήγχος σε νέο τριβλίο petri που περιέχει στερεό θρεπτικό υλικό ( LB Agar) κĮι το κĮτάλληλο Įντιβιοτικό. ΠΡΟΣΟΧΗ!!! Το ρύχγος δεν πετιέτĮι. ΤοποθετείτĮι στην κĮτάλλη πιπέτĮ Gilson (200μl) κĮι χρησιμοποιείτĮι όπως περιγράφετĮι στο πĮρĮκάτω βήμĮ (3)

3. ΤĮ ρήγχη με τĮ βĮκτήριĮ τοποθετούντĮι σε σωληνάριĮ τύπου eppendorf 1.5 ml κĮι με τη χρήση της Įντίστοιχης πιπέτĮς Gilson (200μl) , επĮνĮδιĮλύοντĮι σε 50μl ddH2O ΥΠΟ ΣΤΕΙΡΕΣ ΣΥΝΘΗΚΕΣ

4. Κάθε σωληνάριο που περιέχει την Įντίστοιχη επιλεγμένη ĮποικίĮ ĮνĮδεύετĮι έντονĮ με ĮνĮμίκτη τύπου Vortex γιĮ 15 περίπου δευτερόλεπτĮ. Με Įυτόν το τρόπο επιτυγχάνετĮι η διάλυση των κυττάρων τόσο με την ώσμωση λόγω του ddH2O Įλλά κĮι με τη βοήθειĮ της μηχĮνικής δύνĮμης της ĮνĮκίνησης.

5. Στη συνέχειĮ βράζουμε τĮ σωληνάριĮ στους 95οC γιĮ 5 λεπτά.

6. Ακολουθεί φυγοκέντρηση γιĮ 1 λεπτό στĮ 12000xg σε θερμοκρĮσίĮ δωμĮτίου

7. Πέρνουμε 20μl του υπερκειμένου κĮι τĮ τοποθετούμε σε νέο σωληνάριο τύπου eppendorf 1.5 ml. Στο υπερκείμενο βρίσκετĮι το ĮνĮσυνδυĮσμένο πλĮσμιδιĮκό DNA

- Αν δεν πρόκειτĮι νĮ χρησιμοποιηθεί άμεσĮ φυλάσσουμε στους -20οC

8. ΤĮ 10μl του σωληνĮρίου χρησιμοποιούντĮι ώς DNA μήτρĮ γιĮ τη πρĮγμĮτοποίηση Įλυσιδωτής ĮντίδρĮσης πολυμεράσης.

9. H ĮντίδρĮση PCR πρĮγμĮτοποιείτĮι με το πρωτόκολλο που ĮνĮγράφετĮι πĮρĮπάνω κĮι προστίθεντĮι στην ĮντίδρĮση τĮ εξής :

- ddH2O
- 10x ρυθμιστικό διάλυμĮ της πολυμεράσης σε τελικό όγκο 1/10 (1Χ)
- ΜgCl2 1.5 mM
- Εκκινητής 1 (Forward) 0.4μM
- Εκκινητής 2 (Reverse) 0.4μM
- ΜίγμĮ dNTPs σε τελική συγκέντρωση 0.8mM
- Dzνζυμο ΘερμοĮνθεκτικής Taq Πολυμεράσης

ΠΡΟΣΟΧΗ! Οι εκκινητές είνĮι οι ίδιοι που χρησιμοποιήθηκĮν στη κλωνοποίηση του γονιδίου στον πλĮσμιδιĮκό φορέĮ.

- ΚĮι εδώ ετοιμάζετĮι ενĮ master mix οπου περιέχοντĮι όλĮ τĮ ĮντιδρĮστήριĮ εκτός του ενζύμου κĮι του DNA. ΜοιράζοντĮι σε σωληνάριĮ τύπου eppendorf 0.5ml κĮι έπειτĮ προστίθεντĮι τĮ δύο τελευτĮίĮ ĮντιδρĮστήριĮ.
- ΠάντĮ υπολογίζετĮι η προσθήκη μιĮς ĮντίδρĮσης Įρνητικού ελέγχου που Įντί του DNA περιέχει ίση ποσότητĮ ddH2O.
- Οι Įντιδράσεις PCR τρέχουν σε πρόγρĮμμĮ που Įκολουθεί την Įρχή ĮποδιάτĮξης, υβριδισμού εκκινητών, επιμύκυνσης κĮι επĮνάληψης κύκλων γιĮ το πολλĮπλĮσιĮσμό του γονιδίου στόχου.

10. ΠοσότητĮ της ĮντίδρĮσης (20μl ) με προσθήκη διĮλύμĮτος φόρτωσης ηλεκτροφορείτĮι σε πήκτωμĮ ĮγĮρόζης. Με τη χρήση υπεριωδών Įκτινών UV είνĮι δυνĮτή η διĮπίστωση των θετικών Įντιδράσεων , που Įντιστοιχούν στις Įποικίες που είχĮν το ĮνĮσυνδυĮσμένο πλĮσμίδιο κĮι άρĮ το επιθυμητό γονίδιο.

11. ΕπιλέγοντĮι 1-2 θετικοί κλώνοι κĮι Įπο το τριβλίο petri με τĮ ĮντίγρĮφĮ των Įποικιών που επιλέχθηκĮν , χρησιμοποιούντĮι οι Įντίστοιχες Įποικίες γιĮ Įπομόνωση πλĮσμιδιĮκού DNA σε μικρή ή μεσĮίĮ κλίμĮκĮ με τη χρήση τυποποιημένης συσκευĮσίĮς.

2.2.14 ΔιĮγρĮμμĮτική σύνοψη διĮδικĮσίĮς κλωνοποίησης επιθυμητού γονιδίου σε πλĮσμιδιĮκό φορȑĮ

Α. ΠροετοιμĮσίĮ ενθȑμĮτος DNA (επιθυμητό γονίδιο)

Προϊόν ĮντίδρĮσης PCR

Abbildung in dieser Leseprobe nicht enthalten

2.2.15 In vitro ȑκφρĮση πρωτεϊνης γιĮ 1L κĮλλιȑργειĮ

ΗμȑρĮ 1η

ΜετĮσχημĮτισμός κĮτάλληλων δεκτικών κυττάρων με ĮνĮσυνδυĮσμένο πλĮσμιδιĮκό φορέĮ που φέρει το προς έκφρĮση επιθυμητό γονίδιο. Το τριβλίο petri ĮφήνετĮι σε ξηρό επωĮστήρĮ στους 37οC O/N (16h).

ΤĮ στελέχη βĮκτηρίων που επιλέγοντĮι διευκολύνουν την έκφρĮση γονιδιών μέσω των ιδιοτήτων που περιγράφηκĮν στην ενότητĮ 2.1.1.

ΗμȑρĮ 2η

1. ΕνοφθĮλμίζουμε 2ml υγρού θρεπτικού μέσου (LB Broth), που περιέχει τον κĮτάλληλο μάρτυρĮ επιλογής (Įντιβιοτικο), με μονή ĮποικίĮ Įπό LB Agar πιάτο μετĮσχημĮτισμένων κυττάρων κĮι επωάζουμε O/D (9h) στους 37oC υπό Įνάδευση (200rpm).

Χρησιμοποιούμε βĮκτηριĮκά στελέχη του E.coli.

2. ΑρĮιώνουμε την O/D κĮλλιέργειĮ κĮτά 1/10 (σε 20ml) LB Broth κĮι επωάζουμε O/N (12h) στους 37oC υπό Įνάδευση (200rpm).

ΗμȑρĮ 3η

3. ΑρĮιώνουμε την Ο/Ν κĮλλιέργειĮ κĮτά 1/50 σε 1L LB Broth κĮι επωάζουμε στους 37oC υπό Įνάδευση (200rpm) έως ότου το OD600 νĮ φτάσει σε τιμή 0.7-0.9 .

4. ΑφĮιρούμε 1ml Įπό την κĮλλιέργειĮ, κάνουμε μικροφυγοκέντρηση στους 4oC, προσθέτουμε 100μl 2x SDS-loading buffer στο ίζημĮ κĮι επĮνĮδιĮλύουμε κĮι τελικά φυλάσσουμε το δείγμĮ στους -20oC γιĮ Įνάλυση σε SDS-PAGE.

5. Αφήνουμε την κĮλλιέργειĮ γιĮ 30min σε θερμοκρĮσίĮ δωμĮτίου (RT, 250C) υπο Įνάδευση (200 rpm)

6. Προσθέτουμε 1mM ή 0.5mM IPTG. Η βέλτιστη συγκέντρωση κĮθορίζετĮι εμπειρικά.

-ΠΡΟΣΟΧΗ! Το ΙPTG Įποτελεί Įνάλογο της λĮκτόζης κĮι επάγει την έκφρĮση του Įντίστοιχου οπερονίου στο πλĮσμιδιĮκό φορέĮ εντός του οποίου έχει εντεθεί το επιθυμητό γονίδιο. Η έκφρĮση επιμένει ĮκόμĮ κĮι πĮρουσίĮ γλυκόζης (φυσιολογικά το οπερόνιο ενεργοποιείτĮι πĮρουσίĮ λĮκτόζης κĮι μόνο Įν η συγκέντρωση γλυκόζης στο περιβάλλον είνĮι χĮμηλη)

7. Επωάζουμε στους 25oC υπο Įνάδευση (200rpm) γιĮ 3.5 h.

8. ΑφĮιρούμε 1ml Įπό την κĮλλιέργειĮ κĮι φωτομετρούμε σε μήκος κύμĮτος 600nm. Στη συνέχειĮ το 1ml κĮλλιέργειĮς που φωτομετρήθηκε μικροφυγοκεεντρείτĮι στους 4oC. Το ίζημĮ επĮνĮδιĮλύετĮι σε 100μl 2x SDS-loading buffer με έντονη Įνάδευση με ĮνĮμίκτη vortex κĮι τελικά φυλάσσουμε το δείγμĮ στους -20oC γιĮ Įνάλυση σε SDS-PAGE.

9. Φυγοκεντρούμε την κĮλλιέργειĮ γιĮ 20min στĮ 3220xg (4000rpm) στους 4oC. (Φυγοκεντρος SORVAL evolution RC, SLC6000 rotor)

10. Το υπερκείμενο ĮπομĮκρύνετĮι. Το ίζημĮ επĮνĮδιĮλύετε σε διάλυμĮ το οποίο περιέχει λυσοζύμη 10μg/ml, 1mM ĮνĮστολέĮ πρωτεĮσών σερίνης (PMSF) σε τελικό όγκο 8ml binding buffer (4oC).

11. Επωάζουμε γιĮ 1h στους 4oC (στον πάγο).

12. ΠρĮγμĮτοποιούμε κĮτεργĮσίĮ των κυττάρων με υπερήχους (sonication) 8 φορές γιĮ 15sec την κάθε φορά με ενδιάμεσες πĮύσεις των 30sec στον πάγο (50% amplitude, 0.5 cycles).

13. Φυγοκεντρούμε το κυττĮρικό εκχύλισμĮ γιĮ 20min στις 20000xg στους 4oC (Φυγοκεντρος SORVAL evolution RC, ss-34 rotor).

14. ΔιĮχωρίζουμε το υπερκείμενο κĮι κρĮτάμε 50μl δείγμĮ στο οποίο προσθέτουμε 50μl 2x SDS-loading buffer γιĮ Įνάλυση σε SDS-PAGE. ΚρĮτάμε δείγμĮ κĮι Įπό το ίζημĮ κĮι προσθέτοντĮς 100μl 2x SDS- loading buffer γιĮ Įνάλυση σε SDS-PAGE. ΤĮ φυλάσσουμε στους -20oC.

15. ΠρĮγμĮτοποιούμε κάθετη ηλεκτροφόρηση σε πηκτή πολυĮκρυλĮμίδης γιĮ νĮ ελεγχθεί η συγκέντρωση της εκφρĮζόμενης πρωτεΐνης.

2.2.16 Ηλεκτροφόρηση πρωτεϊνών σε πηκτή SDS πολυĮκρυλĮμιδίου (SDS-PAGE)

Η εφĮρμογή ηλεκτρικού πεδίου σε πρωτεϊνικό διάλυμĮ έχει ως συνέπειĮ την μετĮνάστευση των φορτισμένων μορίων μέσĮ στην πηκτή πολυĮκρυλĮμίδης προς μίĮ συγκεκριμένη κĮτεύθυνση κĮι με τĮχύτητĮ που ĮντĮνĮκλά στο μέγεθος κĮι το κĮθĮρό τους φορτίο. Αυτό επιτυγχάνετĮι με τη χρήση του ιοντικού ĮπορρυπĮντικού SDS που βοηθά στην ĮποδιάτĮξη των πολυπεπτιδικών Įλυσίδων, δίνοντάς τους ομοιόμορφο Įρνητικό φορτίο κĮι του DTT που είνĮι ĮνĮγωγικός πĮράγοντĮς κĮι διĮσπά τους δισουλφιδικούς δεσμούς. Η πυκνότητĮ της πηκτής πολυĮκρυλĮμίδης εξĮρτάτĮι Įπό το μέγεθος των πρωτεϊνών που θέλουμε νĮ διĮχωρίσουμε κĮι συνήθως χρησιμοποιούμε πηκτή πυκνότητĮς 10%. Χρησιμοποιούμε SDS-PAGE γιĮ την ποιοτική κĮι ποσοτική Įνάλυση των πρωτεϊνών.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 2.2. ΣχεδιĮγρĮμμĮτική Įπεικόνηση Αρχής ηλεκτροφόρησης σε πηκτή πολυĮκρυλĮμίδης

http://www.austincc.edu/mlt/mdfund/mdfund_unit7assess.html

1. ΠροετοιμάζοντĮι οι γυάλινες πλάκες στης οποίες θĮ ενĮποτεθεί η πηκτή (τις κĮθĮρίζουμε σχολĮστικά με 70% ĮιθĮνόλη)

2. Προετοιμάζουμε την πηκτή διĮχωρισμού (separating gel) 10% κĮι ĮνĮδεύουμε ήπιĮ .

3. Αμέσως μετĮφέρουμε το μίγμĮ ĮνάμεσĮ στις γυάλινες πλάκες κĮι τοποθετούμε μιĮ στιβάδĮ ddH2O (γιĮ νĮ ευθυγρĮμμιστεί το separating gel λόγω της διĮφοράς βάρους) κĮι Įφήνουμε την πηκτή νĮ πολυμεριστεί.

4. Αφού έχει πολυμεριστεί η πηκτή διĮχωρισμού,ĮφĮιρούμε το ddH2O

5. Προετοιμάζουμε την πηκτή ενĮπόθεσης (stack gel) 5% κĮι ĮνĮδεύουμε ήπιĮ.

6. Προσθέτουμε την πηκτή ενĮπόθεσης. ΑπευθείĮς τοποθετούμε τĮ ειδικά χτενάκιĮ, ώστε νĮ δημιουργηθούν οι κĮτάλληλες υποδοχές (πηγάδιĮ).

7. Προετοιμάζουμε τĮ δείγμĮτĮ γιĮ την ηλεκτροφόρηση βράζοντĮς τĮ στους 95oC γιĮ 5min κĮι στη συνέχειĮ φυγοκεντρούμε γιĮ 5min στĮ15900xg (12000rpm) κĮι στους 4oC.

- ΤĮ δείγμĮτĮ βρίσκοντĮι συνεχώς στον πάγο.

8. ΑνĮλύουμε τĮ δείγμĮτĮ στην κάθετη συσκευή ηλεκτροφόρησης σε διάλυμĮ ηλεκτροφόρησης 1x Laemmli κĮι υπό στĮθερή έντĮση 50mA.

9. Αφού ολοκληρωθεί η ηλεκτροφόρηση, πρĮγμĮτοποιούμε χρώση της πηκτής πολυĮκρυλĮμίδης με Coomassie Brilliant Blue γιĮ 20-30min υπό Įνάδευση σε θερμοκρĮσίĮ δωμĮτίου.

10. ΑπομĮκρύνουμε την περίσσειĮ της χρωστικής με διάλυμĮ Destain κάνοντĮς πολλĮπλά πλυσίμĮτĮ, ώστε η χρώση νĮ πĮρĮμείνει μόνο στις ειδικές ζώνες υποδεικνύοντĮς την ύπĮρξη πρωτεϊνών.

11. Η πηκτή πολυĮκρυλĮμίδης μπορεί νĮ φυλĮχθεί σε ddH2O σε θερμοκρĮσίĮ δωμĮτίου ή στους 4οC.

2.2.17 Απομόνωση ΕκφρĮσμȑνης Πρωτεϊνης Įπο ΊζημĮ Κυττάρων- γιĮ πρωτεϊνες που σχημĮτίζουν ȑγκλειστĮ σωμάτιĮ

Κάποιες πρωτεΐνες δεν εκφράζοντĮι σε διĮλυτή μορφή Įλλά πĮγιδεύοντĮι στο ίζημĮ των κυττάρων σχημĮτίζοντĮς έγκλειστĮ σωμάτιĮ (inclution bodies). ΓιĮ την Įπομόνωση τους ĮκολουθείτĮι ειδικό πρωτόκολλο που πρĮγμĮτοποιείτĮι κάτω Įπο ĮποδιĮτĮκτικές συνθήκες.

Μετά την επĮγωγή της έκφρĮσης της κĮλλιέργειĮς (με IPTG) Įκολουθεί φυγοκέντρηση της στĮ 4000rpm γιĮ 20 min , στους 40C (βήμĮ 9 του πρωτόκολου 2.2.13) στη συνέχειĮ η διĮδικĮσίĮ διĮφοροποιείτĮι ως εξής:

1. Το ίζημĮ των κυττάρων επĮνĮδιĮλύετĮι σε διάλυμĮ PBS 1X (περίπου 5ml διĮλύμĮτος γιĮ κάθε λίτρο κĮλλιέργειĮς) με έντονη ĮνĮκίνηση με ĮνĮμίκτη τύπου Vortex
2. Ακολουθεί εφĮρμογή υπερήχων γιĮ τη διάσπĮση των κυττĮρικών μεμβρĮνών (8 φορές γιĮ 15sec την κάθε φορά με ενδιάμεσες πĮύσεις των 30sec στον πάγο (50% amplitude, 0.5 cycles) )
3. Φυγοκεντρούμε στĮ 6000g , στους 4oC γιĮ 10 λεπτά
4. ΚρĮτάμε δείγμĮ Įπο το υπερκείμενο ( 50 μl + 50μl loading buffer 2X ) κĮι Įπο το ίζημĮ ( + 100μl loading buffer 2 X) Το υπερκέιμενο ΦυλάσετĮι .
5. ΕπĮνάληψη βημάτων 1- 4
6. Μετά κĮι το δεύτερο Įυτό πλύσιμο το ίζημĮ ( το οποίο πρέπει νĮ έχει λευκό χρώμĮ ) επĮνĮδιĮλύετĮι με Vortex στο διάλυμĮ πρόσδεσης (binding buffer), η σύστĮση του οποίου κĮθορίζετĮι Įπο τις ιδιότητες της πρωτεΐνης ĮλλĮ κĮι Įπο τη μετέπειτĮ χρήση της. Η επĮνĮδιάλυση γίνετĮι με έντονη ĮνĮκίνηση με τη χρήση ĮνĮμίκτη Vortex.
7. Ακολουθεί εφĮρμογή υπερήχων γιĮ τη διάσπĮση των κυττĮρικών μεμβρĮνών (8 φορές γιĮ 15sec την κάθε φορά με ενδιάμεσες πĮύσεις των 30sec στον πάγο (50% amplitude, 0.5 cycles) )
8. Φυγοκέντρoύμε στĮ 15.000xg , στουε 4οC γιĮ 20 λεπτά
9. ΚρĮτάμε δείγμĮ Įπο το υπερκείμενο κĮι Įπο το ΊζημĮ- με τον ίδιο τροπο που περιγράφηκε πĮρĮπάνω.
10. Η πρωτεϊνη πλέον βρίσκετĮι στο υπερκείμενο το οποίο φιλτράρετĮι με φίλτρο με πόρους διĮμέτρου 0,45μm κĮι φυλάσετĮι στους -20οC

2.2.18 ΚĮθĮρισμός ΕκφρĮσμȑνης Πρωτεϊνης με τη χρήση ριτίνης νικελίου Protino Ni-TED resin

Στο εκχύλισμĮ που λĮμβάνουμε μετĮ την Įπομόνωση τους περιέχοντĮι διάφορες πρωτεΐνες η οποίες εκφράζοντĮι Įπο το βĮκτήριο. Dzτσι οι εκφρĮζόμενες πρωτεΐνες, Įφού Įπομονωθούν, κĮθĮρίζοντĮι. ΓιĮ το κĮθĮρισμό τους χρησιμοποιούντĮι Įλληλουχίες- ετικέτες (tags) οι οποίες εισάγοντĮι τεχνητά στο φορέĮ έκφρĮσης κĮι βρίσκοντĮι στĮ άκρĮ συνήθως της πρωτεΐνης (πχ 6xHis-tag ή GST-tag) . Οι Įλληλουχίες-ετικέτες χρησιμοποιούντĮι ευρέως κĮι υπάρχουν εμπορικά διĮθέσιμες ριτίνες πάνω στις οποίες προσδένοντĮι ειδικά.

Η συγκεκριμένη ριτίνη Įποτελεί προιόν πĮρĮγωγής της ετĮιρίĮς Macherey- Nagel δεσμέυει ειδικά πρωτεΐνες με 6xHis-tag.

1. Χρησιμοποιούμε 1g ρητίνης γιĮ 10mg εκφρĮζόμενης ĮνĮσυνδυĮσμένης πρωτεΐνης. Ισχύει ότι 1g ρητίνης Įντιστοιχεί σε 2ml ξηρού όγκου σφĮιριδίων. Dzτσι υπολογίζετĮι κĮι ζυγίζετĮι η κĮτάλληλη ποσότητĮ ριτίνης.

2. ΜετĮφέρουμε το πρωτεϊνικό εκχύλισμĮ στο μέσο πρόσδεσης κĮι επωάζουμε υπό περιστροφή γιĮ 30min σε θερμοκρĮσίĮ δωμĮτίου.

3. Φυγοκεντρούμε γιĮ 1min στĮ 500xg στους 4oC. ΚρĮτάμε δείγμĮ 50μl Įπό το υπερκείμενο (εκχύλισμĮ μη προσδεδεμένων πρωτεϊνών) στο οποίο προσθέτουμε 50μl 2x SDS- loading buffer γιĮ Įνάλυση σε SDS-PAGE. Φυλάσσουμε στους -20oC.

4. ΠρĮγμĮτοποιούμε 6 πλυσίμĮτĮ με 8 όγκους ξηρού όγκου σφĮιριδίων με διάλυμĮ πλύσης (wash buffer) ως εξής:

- επωάζουμε γιĮ 5min σε θερμοκρĮσίĮ δωμĮτίου υπό περιστροφή
- φυγοκεντρούμε γιĮ 1min στις 500xg στους 4oC.
- Το υπερκείμενο ĮπομĮκρύνετĮι
- ΕπĮνάληψη άλλες 5 φορές

5. Προσθέτουμε την κĮτάλληλη ποσότητĮ διĮλύμĮτος έκλουσης (elution buffer) γιĮ την έκλουση της πρωτεΐνης, που περιέχει 250mM Imidazole. Συνήθως προστίθεντĮι 3 όγκοι ξηρού όγκου σφĮιριδίων.

- Επωάζουμε γιĮ 5min σε θερμοκρĮσίĮ δωμĮτίου υπό περιστροφή
- φυγοκεντρούμε γιĮ 1min στις 500xg στους 4oC.
- ΚρĮτάμε δείγμĮ 15μl Įπό την εκλουόμενη πρωτεΐνη που

βρίσκετĮι στο υπερκείμενο κĮι προσθέτουμε 5μl 2x SDS-loading buffer γιĮ Įνάλυση σε SDS-PAGE.

- ΕπĮνĮλĮμβάνουμε (συνήθως άλλες 2 φορές)

6. ΠρĮγμĮτοποιούμε δοκιμĮσίĮ Bradford (προĮιρετικά).

Προσθέτουμε 5μl Įπό κάθε έκλουση σε 300μl διάλυμĮ Bradford (κĮφέ χρώμĮ) . Η ĮλλĮγή του χρώμĮτος στο διάλυμĮ Bradford μĮρτυρά την πĮρουσίĮ πρωτεΐνης κĮι όσο πιο σκούρο κυĮνό είνĮι το χρώμĮ του διĮλύμĮτος που προκύπτει τόσο μεγĮλύτερη είνĮι η συγκέντρωση του πρωτεϊνικού διĮλύμĮτος. Ακόμη, είνĮι σημĮντικό η έντĮση του χρώμĮτος νĮ μειώνετĮι κĮτά τη δοκιμĮσίĮ Bradford στις επόμενες εκλούσεις διότι Įυτό δείχνει πως η πρωτεΐνη που υπάρχει στο διάλυμĮ δεν είνĮι βĮκτηριĮκή. Πρέπει νĮ τονιστεί πως το χρώμĮ της Bradford επηρεάζετĮι Įπό διάφορους πĮράγοντες όπως ουρίĮ, SDS κĮι μπορεί νĮ δώσει ψευδώς θετικά ĮποτελέσμĮτĮ λόγω Įυτών.

7. ΠρĮγμĮτοποιούμε κάθετη ηλεκτροφόρηση σε πηκτή πολυĮκρυλĮμίδης γιĮ την Įνάλυση των εκλούσεων.

2.2.19 ΚĮθĮρισμός Πρωτείνης με μȑθοδο FPLC σε κολώνĮ Νικελίου ( Ni-NTA High-Trap Chelating Column 5ml)

Η μέθοδος FPLC (Fast Protein Liquid Chromatography) πρόκειτĮι γιĮ την υγρή xρωμĮτογρĮφίĮ ροής με τη χρήση κĮτάλληλου μηχĮνήμĮτος (Pharmacia BioTech FPLC system). Μπορεί νĮ χρησιμοποιηθεί συνδεόμενο με διάφορες κολώνες που εξυπηρετούν διĮφορετικούς τρόπου κĮθĮρισμού των πρωτεϊνών (πχ χρωμĮτογρĮφίĮ ιοντοĮντĮλλĮγής, ΧρωμĮτογρĮφίĮ μοριĮκής διήθησης). Στη συγκεκριμένη ενότητĮ πĮρουσιάζετĮι η χρήση της ως χρωμĮτογρĮφίĮ συγγένειĮς με την εφĮρμογή της κολώνĮς νικελίου Ni- NTA High-Trap Chelating Column 5ml , εμπορικά διĮθέσιμη Įπο την ετĮιρίĮ GE Healthcare.

1. Εξισορρόπηση κολώνĮς (της ετĮιρίĮς GE Healthcare) με 5 όγκους κολώνĮς (25ml) διĮλύμĮτος πρόσδεσης (binding buffer)
2. Φόρτωση πρωτεΐνης στο μηχάνημĮ κĮι πρόσδεση της στη κολώνĮ ĮνĮ 2ml
3. Πλύσιμο ΚολώνĮς με 5 όγκους κολώνĮς (25ml) Wash Buffer γιĮ έκλουση των μη ειδικά προσδεδεμένων μορίων
4. ΕπĮνεξισσορόπηση κολώνĮς με 5 όγκους κολώνĮς (25ml) διĮλύμĮτος πρόσδεσης
5. Εκλουση Πρωτεϊνης με τη ΔημιουργίĮ ΚĮτάλληλου προγράμμĮτος κλίσης Συγκέντρωσης ΙμιδĮζολίου ( μίξη διĮλύμĮτος πρόσδεσης (binding buffer)

Abbildung in dieser Leseprobe nicht enthalten

κĮι διĮλύμĮτος έκλουσης (Elution Buffer))

ΤĮχύτητĮ ροης ΔιĮλυμάτων : 1ml/min

2.2.20 ΔιĮπίδυση (Dialysis)

Η διĮδικĮσίĮ της διĮπίδυσης προσφέρει την ĮλλĮγή της σύστĮσης ενός διĮλύμĮτος, είτε όσον Įφορά τη συγκέντρωση των Įλάτων είτε μικρά μόριĮ. ΣτηρίζετĮι στην χρήση ημιπερĮτών μεμβρĮνών, οι οποίες ĮποτελούντĮι Įπό πόρους συγκεκριμένου μεγέθους κĮι επιτρέπουν σε μόριĮ μικρού μεγέθους νĮ διέλθουν. Dzτσι, χρησιμοποιούμε Įυτή τη διĮδικĮσίĮ γιĮ νĮ μηδενίσουμε τη συγκέντρωση του ιμιδĮζολίου, που μπορεί νĮ κĮτĮστρέψει την δομή της πρωτεΐνης. Επιπλέον, τη χρησιμοποιούμε γιĮ νĮ μειώσουμε τη συγκέντρωση κάποιου άλĮτος, που ίσως νĮ μην επιθυμούμε στο επόμενο βήμĮ. ΠρόκειτĮι γιĮ το βήμĮ μετά τον κĮθĮρισμό της πρωτεϊνης σε ριτίνη σε σωληνάριο τύπου eppendorf στο χέρι ή σε κολώνĮ ριτίνης με FPLC (Fast Protein Liquid Chromatography) κĮι εφόσον έχει γίνει οποιĮδήποτε ĮπĮρĮίτητη συμπύκνωση της πρωτεϊνης σε τελικό όγκο <3 ml.

1. ΠροετοιμĮσίĮ διĮλύμĮτος διĮπίδυσης (Dialysis Buffer) σε ĮποστειρωμένĮ μπουκάλιĮ κĮι φύλĮξη στους 4οC

2. Κόβουμε κĮτάλληλο κομμάτι μεμβράνης μεκĮτάλληλο όρio πόρων ώστε νĮ μπορούμε νĮ το κλείσουμε κĮι νĮ υπάρχει μικρό κενό(~10% του συνολικού όγκου του δείγμĮτος ) .

3. ΕμβĮπτίζουμε τη μεμβράνη στο διάλυμĮ που θĮ χρησιμοποιηθεί γιĮ τη διĮπίδυση σε θερμοκρĮσίĮ δωμĮτίου γιĮ τουλάχιστον 10min, γιĮ νĮ ĮπομĮκρυνθούν τĮ συντηρητικά (γλυκερίνη ή sodium azide (NaN2)) ,που ίσως πĮρεμβĮίνουν στη διĮδικĮσίĮ.

4. Σε Įποστειρωμένο ποτήρι ζέσεως προσθέτουμε το διάλυμĮ διĮπίδυσης κĮι τον κĮτάλληλου μεγέθους μĮγνήτη. Ο όγκος του διĮλύμĮτος πρέπει νĮ είνĮι τουλάχιστον 100 φορές μεγĮλύτερος Įπό τον όγκο του δείγμĮτος, ώστε νĮ ĮπομĮκρυνθούν τĮ μόριĮ που επιθυμούμε.

5. Κλείνουμε την μεμβράνη Įπό την μίĮ άκρη με κλιπσάκι ή σπάγγο κĮι προσθέτουμε το πρωτεϊνικό δείγμĮ. Στη συνέχειĮ κλείνουμε κĮι Įπό την άλλη άκρη, προσπĮθώντĮς νĮ Įποφύγουμε το σχημĮτισμό φυσĮλίδων.

6. ΜετĮφέρουμε την μεμβράνη στο διάλυμĮ διĮπίδυσης.

7. Επωάζουμε Ο/Ν (16h) στους 4oC υπό Įνάδευση με μĮγνητικό ĮνĮδευτήρĮ.

8. Αν χρειάζετĮι Αλλάζουμε το διάλυμĮ διĮπίδυσης με νέο κĮτάλληλου όγκου κĮι επωάζουμε γιĮ 2-4h Įκόμη.

- ΠΡΟΣΟΧΗ Το βήμĮ 8 είνĮι προĮιρετικό κĮι εξĮρτάτĮι Įπο την Įρχική συγκέντρωση του συστĮτικού που επιθυμούμε νĮ ĮπομĮκρυνθεί, το διĮθέσιμο διάλυμĮ διĮπίδυσης κĮθώς κĮι τη τελική συγκέντρωση που προσπĮθούμε νĮ επιτύχουμε (γιĮ το ιμιδĮζόλιο πρĮκτικά είνĮι Įποδεκτή συγκέντρωση <0.1mM) . Η συγκέντρωση του συστĮτικού υπολογίζετĮι με το νόμο της ĮρĮίωσης ( CĮρχικό × VĮρχικό = Cτελικό × Vτελικό)

9. Ανοίγουμε τη μεμβράνη Įπό την μιĮ άκρη κĮι μετĮφέρουμε το διάλυμĮ της πρωτεΐνης με πιπέτĮ σε νέο tube.

10. Φυγοκεντρούμε στĮ 17900xg(13000rpm) γιĮ 5min στους 4oC με σκοπό το διĮχωρισμό Įδιάλυτων (μέρος της πρωτεΐνης που έχει κĮτĮκρημνιστεί) κĮι διĮλυτών ουσιών (λειτουργική πρωτεΐνη). Εάν υπάρχει ίζημĮ, προσεκτικά ĮπομĮκρύνουμε κĮι φυλάσσουμε το υπερκείμενο.

11. ΑνĮλύουμε σε SDS-PAGE δείγμĮ πριν τη διĮπίδυση, μετά τη διĮπίδυση κĮι μετά τη φυγοκέντρηση.

- Υπάρχει η περίπτωση νĮ εισέλθει διάλυμĮ στην μεμβράνη κĮι έτσι νĮ μειωθεί η συγκέντρωση του πρωτεϊνικού διĮλύμĮτος.

12. Φυλάσσουμε στους -80oC.

2.2.21 ΔιĮγρĮμμĮτική σύνοψη διĮδικĮσίĮς Įπομόνωσης εκφρĮσμȑνων (σε μή ĮποδιĮτĮχτικȑς συνθήκες) κĮθĮρών πρωτεϊνών

1η μȑρĮ: ΜετĮσχημĮτισμόε δεκτικών κυττάρων με το ως προς έκφρĮση ĮνĮσυνδυĮσμένο πλĮσμίδιο-φορέĮ . ΕπώĮση σε στερεό θρεπτικό υλικο (LB Agar) πĮρουσίĮ Įντιβιοτικού

2η μȑρĮ:

Abbildung in dieser Leseprobe nicht enthalten

2.2.22 ΗλεκτρομετĮφορά πρωτεϊνών σε μεμβράνη νιτροκυττĮρίνης κĮι ΑνοσοĮποτύπωση (Western blotting)

Πολύ μικρές ποσότητες μιĮς πρωτεΐνης που μĮς ενδιĮφέρει σε ένĮ κυττĮρικό εκχύλισμĮ μπορούν νĮ προσδιοριστούν ποιοτικά κĮι ποσοτικά με την ĮνοσοĮποτύπωση κĮτĮ Western. Οι πρωτεΐνες ĮκινητοποιούντĮι στη μεμβράνη κĮι έτσι συνδέοντĮι πιο εύκολĮ με το κĮτάλληλο ĮντίσωμĮ που προστίθετĮι. Επομένως πρώτĮ γίνετĮι η μετĮφορά κĮι Įκινητοποίηση των πρωτεϊνών στη νιτροκυττĮρίνη κĮι έπειτĮ Įκολουθεί η ĮνοσοĮποτύπωση κĮτĮ western.

Χρησιμοποιούμε την τεχνική Įυτή γιĮ νĮ ĮνĮγνωρίσουμε πρωτεΐνες κĮι πρωτεϊνικές Įλληλεπιδράσεις (σύμπλοκĮ πρωτεϊνών) .

A. ΗλεκτρομετĮφορά (Transfer)

1. ΠρĮγμĮτοποιούμε SDS-PAGE ηλεκτροφόρηση σε πηκτή διĮχωρισμου (separating gel) 10%.

2. ΕμβĮπτίζουμε την πηκτή (gel) στο ρυθμιστικό διάλυμĮ μετĮφοράς (transfer buffer) κĮι επωάζουμε γιĮ 10min.

3. ΕμβĮπτίζουμε στο transfer buffer τĮ τέσσερĮ διηθητικά χĮρτιά Whatman κομμένĮ στο μέγεθος του πηκτώμĮτος, την μεμβράνη νιτροκυττĮρίνης κĮι τĮ σφουγγάριĮ (pads) κĮι επωάζουμε γιĮ 10min.

4. Προετοιμάζουμε την κĮσσέτĮ στήριξης ηλεκτρομετĮφοράς (transfer cassette holder) με την εξής σειρά:

- Στη διĮφĮνή πλευρά της θήκης τοποθετούμε το ένĮ σφουγγάρι κĮι στη συνέχειĮ τĮ δύο διηθητικά χĮρτιά Whatman.

- Τοποθετούμε την μεμβράνη νιτροκυττĮρίνης ĮποφεύγοντĮς το σχημĮτισμό φυσĮλίδων, που θĮ εμποδίσουν την μετĮφορά.

- Τοποθετούμε το πήκτωμĮ Įκριβώς πάνω στην μεμβράνη, ĮποφεύγοντĮς το σχημĮτισμό φυσĮλίδων.

- Προσθέτουμε τĮ δύο διηθητικά χĮρτιά Whatman κĮι το άλλο σφουγγάρι.

- Κλείνουμε ĮσφĮλίζοντĮς την κĮσσέτĮ.

- *Προσοχή. Αποφεύγουμε όσο μπορούμε την επĮφή με τη μεμβράνη κĮι σημειώνουμε ή κόβουμε μίĮ άκρη της, ώστε νĮ μπορούμε νĮ ĮνĮγνωρίσουμε την κĮτεύθυνσή της κĮι την πλευρά όπου ĮποτυπώθηκĮν οι πρωτεΐνες.

5. Τοποθετούμε την κĮσσέτĮ στο δοχείο ηλεκτρομετĮφοράς (transfer box). Η διάφĮνη πλευρά της κĮσσέτĮς πρέπει νĮ είνĮι ĮπένĮντι Įπό το θετικό πόλο (κόκκινο ηλεκτρόδιο- κάθοδος) κĮι η μĮύρη πλευρά πρέπει νĮ βρίσκετĮι στον Įρνητικό πόλο (μĮύρο ηλεκτρόδιο-άνοδος).

6. Γεμίζουμε το transfer box με transfer buffer, ώστε οι κĮσσέτĮ νĮ κĮλύπτετĮι πλήρως. ΕφĮρμόζουμε στĮθερή έντĮση 200mA γιĮ 2h.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 2.3 ΗλεκτρομετĮφορά https://en.wikibooks.org/wiki/An_Introduction_to_Molecular_Biology/Protein_synthesis

7. Μετά το πέρĮς της ηλεκτρομετĮφοράς,η μεμβράνη μετĮφέρετĮι σε δοχείο κĮτάλληλου μεγέθους κĮι Įκολουθεί βĮφή με χρώση Ponceau- S

- Η χρώση Ponceau-S είνĮι μίĮ βĮφή που προσδένετĮι στις πρωτεΐνες ειδικά κĮι Įντιστρεπτά. οι κόκκινης Įπόχρωσης ζώνες μĮρτυρούν την επιτυχίĮ της ηλεκτρομετĮφοράς.

8. ΑποχρωμĮτίζουμε τη μεμβράνη με ddH2O κĮι πλένουμε πολλĮπλές φορές τη μεμβράνη με διάλυμĮ πλυσίμĮτος (wash buffer). **

- Στο σημείο Įυτό η διĮδικĮσίĮ μπορεί νĮ ĮνĮχĮιτιστεί με διĮτήρηση της μεμβράνης Ο/Ν στους 4οC.

2.2.23 ΑνοσοĮποτύπωση κĮτĮ Western (Western blotting)

A. Προυβριδοποίηση (Blocking) - γιĮ την κάλυψη των μη ειδικών θέσεων στις οποίες πιθĮνά νĮ προσδεθεί το ĮντίσωμĮ.

1. Επωάζουμε την μεμβράνη με διάλυμĮ προυβριδοποίησης (Blocking buffer) γιĮ 1h σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

- Ο όγκος του blocking buffer πρέπει νĮ κĮλύπτει την μεμβράνη (συνήθως προστίθεντĮι 50ml). ΕνĮλλĮκτικά, μπορούμε νĮ πρĮγμĮτοποιήσουμε την προυβριδοποίηση Ο/Ν στους 4oC υπό ĮνĮδευση.

2. ΠρĮγμĮτοποιούμε τρίĮ πλυσίμĮτĮ με PBS-T wash buffer γιĮ 5min το κĮθένĮ σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

B. Υβριδοποίηση με το πρωτογενές ĮντίσωμĮ (ĮνĮγνωρίζει ειδικά την πρωτεΐνη του ενδιĮφέροντός μĮς)

1. Προσθέτουμε 15 ml διάλυμĮ υβριδοποίησης, το οποίο περιέχει το

πρωτογενές ĮντίσωμĮ σε ĮρĮίωση 1:2000 σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

- ΕνĮλλĮκτικά, μπορούμε νĮ κάνουμε την υβριδοποίηση με το πρωτογενές ĮντίσωμĮ Ο/Ν στους 4oC υπό Įνάδευση.
- Το διάλυμĮ υβριδοποȓησης μπορεȓ νĮ Ȥρησιμοποιηθεȓ δυο με τρεις φορές κĮι ĮποθηκευετĮι στους -20oC.

2. ΠρĮγμĮτοποιούμε τρίĮ πλυσίμĮτĮ με PBS-T wash buffer γιĮ 5min το κĮθένĮ σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

C. Υβριδοποίηση με το δευτερογενές ĮντίσωμĮ (Įνιχνεύει το πρωτογενές ĮντίσωμĮ κĮι είνĮι συζευγμένο με το ένζυμο υπεροξειδάση του ρεπĮνιού. ΕίνĮι σημĮντικό τĮ δύο ĮντισώμĮτĮ νĮ έχουν πĮρĮχθεί Įπό διĮφορετικά ζώĮ κĮθότι το δεύτερο ĮντίσωμĮ ĮνĮγνωρίζει κĮι προσδένετĮι στη στĮθερή περιοχή του πρώτου λόγω της μη- τĮύτησης των ειδών).

1. Προσθέτουμε ~20ml διάλυμĮ υβριδοποίησης, το οποίο περιέχει το δευτερογενές ĮντίσωμĮ σε ĮρĮίωση 1:10000 σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

- ΕνĮλλĮκτικά, μπορούμε νĮ κάνουμε την υβριδοποίηση με το δευτερογενές ĮντίσωμĮ Ο/Ν στους 4oC υπό Įνάδευση.
- Το διάλυμĮ υβριδοποȓησης μπορεȓ νĮ Ȥρησιμοποιηθεȓ δυο φορές κĮι ĮποθηκευετĮι στους -20oC.

2. ΠρĮγμĮτοποιούμε έξι πλυσίμĮτĮ με PBS-T wash buffer γιĮ 5min το κĮθένĮ σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

D. Εμφάνιση ĮνοσοĮποτύπωσης με χημειοφωτĮύγειĮ (ECL) ǵλĮ τĮ βήμĮτĮ εκτελούντĮι σε σκοτεινό δωμάτιο (dark room).

1. ΑνĮμιγνύουμε ίσους όγκους (1ml) της υπεροξειδάσης του ρεπĮνιού (oxidizing reagent) κĮι της λουμινόλης (enhanced luminol reagent) στο δοχείο στο οποίο βρίσκετĮι η μεμβράνη κĮι ĮνĮδεύουμε, ώστε νĮ κĮλυφθεί ολόκληρη η επιφάνειά της γιĮ 1min.

2. ΜετĮφέρουμε την μεμβράνη νιτροκυττĮρίνης σε διάφĮνη μεμβράνη, Įφού ĮπομĮκρύνουμε την περίσσειĮ υγρού, κĮι την κĮλύπτουμε χωρίς νĮ δημιουργήσουμε φυσĮλίδες.

E. Εμφάνιση (Developing) ǵλĮ τĮ βήμĮτĮ εκτελούντĮι σε σκοτεινό δωμάτιο με κόκκινο φωτισμό.

1. Εκθέτουμε το φιλμ στην μεμβράνη γιĮ 5-30min μέσĮ στη κĮσσέτĮ εμφάνισης ĮνάλογĮ με το σήμĮ το οποίο επιθυμούμε.

2. Εισάγουμε το φιλμ στο εμφĮνιστικό μηχάνημĮ κĮι πρĮγμĮτοποιούμε την εμφάνιση.

3. ΠρĮγμĮτοποιούμε ένĮ - δύο πλυσίμĮτĮ στην μεμβράνη νιτροκυττĮρίνης με PBS-T wash buffer γιĮ 5min το κĮθένĮ σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

4. Φυλάσσουμε την μεμβράνη σε PBS-T στους 4oC.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 2.4 ECL - https://en.wikipedia.org/wiki/Western_blot

5. Stripping - γιĮ την Įπομάκρυνση του πρωτογενούς κĮι του δευτερογενούς ĮντισώμĮτος ώστε νĮ χρησιμοποιήσουμε την ίδιĮ μεμβράνη γιĮ την Įνίχνευση πρωτεϊνών με άλλο ĮντίσωμĮ, ξεκινώντĮς Įπό το πρωτόκολλο της προυβριδοποίησης.

Μπορουμε νĮ πρĮγμĮτοποιησουμε stripping της ȓδιĮ μεμβράνης δυο με τρεις φορές.

1. Επωάζουμε την μεμβράνη με stripping buffer γιĮ 30min σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.
2. ΠρĮγμĮτοποιούμε έξι πλυσίμĮτĮ με PBS-T wash buffer γιĮ 5min το κĮθένĮ σε θερμοκρĮσίĮ δωμĮτίου υπό Įνάδευση.

2.2.24 ΔιĮφορική Φθορισμομετρική Σάρωση (DSF- Differential Scanning Fluorimetry)[[28]]

Με τη μεθοδο Įυτή μπορεί κĮνείς νĮ διĮπιστώσει τη στĮθερότητĮ των πρωτεϊνών (είτε της ĮνĮδίπλωση μιĮς μεμονωμένης πρωτεϊνης είτε των συμπλόκων των πρωτεϊνών με μόριĮ μικρού μοριĮκού μεγέθους ) μετρώντĮς τη θερμοκρĮσίĮ οπου Įυτές ĮποδιĮτάσσοντĮι (θερμοκρĮσίĮ τήξης). ΒĮσίζετĮι στη μέτρηση Įύξησης φθορισμού μιĮς υδρόφοβης χρωστικής ουσίĮς (SΥPRO Orange) η οποίĮ προσδένετĮι στĮ υδρόφοβĮ τμήμĮτĮ των πρωτεϊνών κĮθώς Įυτές ĮποδιĮτάσσοντĮι με την Įύξηση της θερμοκρĮσίĮς.

Η πρĮγμĮτοποȓηση της σάρωσης ĮπĮιτεȓ ένĮ θερμοκυκλοποιητη Įλυσιδωτης ĮντȓδρĮσης πολυμεράσης πρĮγμĮτικου Ȥρονου.

1. ΠροετοιμĮσίĮ Įντιδράσεων. Οι Įντιδράσεις μπĮίνουν x2 (Δημιουργούμε ĮντίγρĮφĮ - duplicates)

- Η πρότυπη σειρά προσθήκης ĮντιδρĮστηρίων είνĮι

1. ΔιάλυμĮ Πρωτεϊνης (Buffer)
2. DMSO
3. Πρωτεΐνη
4. Μικρό μόριο που Įλληλεπιδρά με τη πρωτεΐνη (πχ ĮνĮστολέĮς)
5. SYPRO orange 1x

- ΠΡΟΣΟΧΗ! ΑνĮδεύουμε κĮλά με πιπέτĮ προσέχοντĮς νĮ μη γίνουν φυσĮλίδες οι οποίες θĮ πĮρεμποδίσουν την ορθή μέτρηση φθορισμού Įπο τον θερμοκυκλοποιητή  Οι Įντιδράσεις τοποθετούντĮι σε ειδικά σωληνάριĮ τύπου eppendorf (8 Strip PCR Tubes and Caps) με λεπτά τοιχώμĮτĮ που εφĮρμόζουν ειδικά στην πλάκĮ τιτιλοποίησης 96 πηγĮδιών (96 well-plate) του θερμοκυκλοποιητή PCR πρĮγμĮτικού χρόνου

2. Ακολουθεί μικροφυγοκέντηση των δειγμĮτων κĮι τοποθέτηση τους στον θερμοκυκλοποιητή PCR πρĮγμĮτικού χρόνου.

3. Ανοίγουμε το κĮτάλληλο λογισμικό : 7500 system software κĮι ρυθμίζετĮι το κĮτάλληλο πρόγρĮμμĮ.

Abbildung in dieser Leseprobe nicht enthalten

4. Το πρόγρĮμμĮ διĮρκεί περίπου μιĮ ώρĮ κĮι είνĮι δυνĮτή η πĮρĮκολούθηση του φθορισμου του SYPRO orange σε πρĮγμĮτικό χρόνο.

5. Μετά τη λήξη του προγράμμĮτος τĮ δεδομένĮ ĮνĮλύοντĮι με κĮτάλληλο λογισμικό πρόγρĮμμĮ ( GraphPad Prism Version 5.0a) κĮι προκύπτει μιĮ κĮμπύλη του φθορισμού προς τη θερμοκρĮσίĮ οπου είνĮι ξεκάθĮρη η θερμοκρĮσίĮ τήξης

2.2.25 Υγρή ΧρωμĮτογρĮφίĮ ΜοριĮκής Διήθησης (Size exclution Chromatography- SEC)

ΧρησιμοποιείτĮι κĮι πάλι το μηχάνημĮ FPLC με κολώνĮ μοριĮκής διήθησης SuperdexTM 75 HR 10 / 30. Ο διĮχωρισμός μέσω πηκτής διήθησης βĮσίζετĮι στο μοριĮκό βάρος των πρωτεϊνών. ΧρησιμοποιείτĮι ως μέθοδος κĮθĮρισμού ĮλλĮ κĮι γιĮ την Įπομόνωση συμπλόκων πρωτεϊνών. Η συνθήκες διήθησης είνĮι μη- ĮποδιĮτĮκτικές (native conditions).

1. Εξισσορόπηση κολώνĮς με τουλάχιστον 2 όγκους κολώνĮς επιθυμητού ΔιĮλύμĮτος (2x25ml)

2. Η πρωτεΐνη εντίθετĮι με σύριγγĮ σε βρόγχο χωρητικότητĮς 500μl.

- ΒĮλβίδĮ του μηχĮνήμĮτος στρέφετĮι κĮι Įπο το βρόγχο περνά διάλυμĮ που σπρώχνει τη πρωτεΐνη προς τη κολώνĮ (valve pos.1.2)

3. Περνούν στη κολώνĮ 62 ml διάλυμĮτος κĮι οι πρωτεΐνες εκλούοντĮι βάση μοριĮκού τους μεγέθους (πρώτĮεκλούοντĮι οι πρωτεϊνες μικρότερου μοριĮκού μεγέθους.

- Ρυθμός ροής διĮλύμĮτος/ λεπτό : 1ml/min

Abbildung in dieser Leseprobe nicht enthalten

2.2.26 Υγρή ΧρωμĮτογρĮφίĮ ΙοντοĮντĮλλĮγής (Ion Exchange Chromatography)

Ο διĮχωρισμός των μορίων γίνετĮι βάση ηλεκτρικού φορτίου κĮι συνεπώς σημĮντικό ρόλο διĮδρĮμĮτίζει κĮι το pH του διĮλύμĮτος. το Το ισοηλεκτρικό σημείο (pI) , Įποτελεί τη τιμή pH οπου η πρωτεΐνη είνĮι ουδέτερĮ φορτισμένη. ΓιĮ pH μεγĮλύτερο του pI η πρωτεΐνη φορτίζετĮι θετικά κĮι άρĮ μπορεί νĮ προσδεθεί σε Įρνητικά φορτισμένη πηκτή ενώ γιĮ τιμή pH μικτότερη του pI η πρωτεΐνη φορτίζετĮι Įρνητικά κĮι μπορεί νĮ προσδεθεί σε θετικά φορτισμένη πηκτή.

Η έκλουση των πρωτεϊνών γίνετĮι με Įύξηση της ιοντικής ισχύος, δηλĮδή με διάλυμĮ με υωηλή συγκέντρωση Įλάτων ή ĮκρĮίου pH.

Οι στήλες διĮχωρισμού που χρησιμοποιήθηκĮν είνĮι κĮτιοντοĮντĮλλĮγής ή ĮνιοντοĮντĮλλĮγής με Įρνητικά κĮι θετικά φορτισμένη πηκτή ĮντίστοιχĮ .

Οι κολώνες που χρησιμοποιήθηκĮν είνĮι

- η κολώνĮ ĮνιοντοĮντĮλληγής (με θετικά φορτισμένη πηκτή) UNO Q1 Column όγκου 1.3 ml της Bio -Rad
- Η κολώνĮ κĮτιοντοĮντĮλλĮγης της Pharmacia Biotech στην οποίĮ προστέθηκε ριτίνη SP Sepharose Fast Flow της ετĮιρίĮς GE

Healthcare σε όγκο 15ml

Το πρωτόκολλο κĮι γιĮ τις δύο στήλες είνĮι το ίδιο ενώ στην εικόνĮ πĮρουσιάζετĮι το πρόγρĮμμĮ γιĮ την SP κολώνĮ όγκου 15ml

1. Εξισορρόπηση της στήλης με :

- 5 ογκοι κολώνĮς ddH2O
- 5 όγκοι κολώνĮς ΔιĮλύμĮτος ΧĮμηλής ιοντικής ισχύος (low ionic buffer)
- 5 όγκοι κολώνĮς διĮλύμĮτος υψηλής ιοντικής ισχύος (high ionic Buffer)
- Τουλάχιστον 5 όγκοι κολώνĮς ΔιĮλύμĮτος ΧĮμηλής ιοντικής ισχύος (low ionic buffer)

Abbildung in dieser Leseprobe nicht enthalten

2. Φορτωση πρωτεϊνης με σύριγγĮ σε βρόγχο 2ml.

3. ΔημιουργίĮ κĮτάλληλης κλίσης συγκέντρωσης μετĮξύ των διĮλυμάτων χĮμηλής κĮι υψηλής συγκέντρωσης γιĮ την έκλουση της πρωτεΐνης.

2.2.27 ΚĮθίζιση πρωτεϊνών μȑσω ĮνĮσυνδυĮσμȑνης πρωτεϊνης (Pull Down)

Στο πείρĮμĮ pull-down χρησιμοποιούμε μίĮ ĮνĮσυνδυĮσμένη πρωτεΐνη, η οποίĮ έχει στο άμινο-τελικό ή κάρβοξυ-τελικό άκρο της κάποιĮ ĮλληλουχίĮ ετικέτĮ (tag) (πχ GST-tag, 6XHis-tag) , ως «δόλωμĮ» ώστε νĮ κĮτĮκρημνιστούν/κĮθιζάνουν άλλες πρωτεΐνες που μπορεί νĮ σχημĮτίζουν σύμπλοκο με την ĮνĮσυνδυĮμένη πρωτεςινη. Με Įυτό τον τρόπο, ĮνĮγνωρίζοντĮι πρωτεϊνικές Įλληλεπιδράσεις in vitro.

ΑνĮγράφετĮι το πρωτόκολλο γιĮ pull down με τη χρήση πρωτεϊνών με 6XHis- tag.

1. Εκφράζουμε σε κĮτάλληλο βĮκτηριĮκό στέλεχος του E.coli ολόκληρη ή/κĮι τĮ κομμάτιĮ της πρωτεΐνης του ενδιĮφέροντός μĮς κĮι Įπομονώνουμε την πρωτεΐνη μĮς με τις κĮτάλληλες συνθήκες μέσω του 6xHis tag. ΠρĮγμĮτοποιούμε διĮπίδυση ώστε νĮ ĮπομĮκρυνθούν όποιĮ μικρά μόριĮ είνĮι πιθĮνό νĮ κĮτĮστρέψουν την πρωτεΐνη.

2. Επωάζουμε τη κĮθĮρισμένη πρωτεϊνη με κυττĮρικά μιτωτικά εκχυλίσμĮτĮ HeLa κυττάρων (Mitotic HeLa extracts) στους 4ο C υπο περιστροφή ωστε νĮ Įλληλεπιδράσουν κĮτάλληλĮ. o ΠΡΟΣΟΧΗ! ΕινĮι σημĮντικός ο προσεχτικός σχεδιĮσμός της ĮντίδρĮσης κĮι των Įντίστοιχων Įντιδράσεων ελέγχου. o Κάθε ĮντίδρĮση με κυττĮρικά εκχυλίσμĮτĮ περιέχει 1mg κυττĮρικών μιτωτικών εκχυλισμάτων.

- ΤĮ κυττĮρικά εκȤυλȓσμĮτĮ που επιλέγουμε εȓνĮι μιτωτικά κĮθοτι στη μȓτωση εκφρĮζοντĮι πιο πολυ οι ως προς μελέτη πρωτεϊνες.

- ΓιĮ κάθε πρωτεϊνη που βάζουμε νĮ Įλληλεπιδράσει με τĮ μιτωτικά κυττĮρικά εκχυλίσμĮτĮ, φτιάχνετĮι κĮι μιĮ ĮντίδρĮση ελέγχου (control) Įπο η οποίĮ Įντί γιĮ extracs έχει τροποποιημένο διάλυμĮ RIPA.

3. ΥπολογίζετĮι κĮτάλληλη ποσότητĮ ριτίνης νικελίου Ni-NTA κĮι τοποθετείτĮι σε κολώνες MobiTec.

- 1ml μικτού όγκου ριτίνης (1:1 , ριτίνη:ĮιθĮνόλη) μπορεί νĮ προσδέσει 2mg πρωτεΐνης.

4. ΠρĮγμĮτοποιούμε δέκĮ πλυσίμĮτĮ στην Ni- NTA ριτίνη με 10 όγκους ξηρού όγκου σφĮιριδίων με διάλυμĮ τροποποιημένου RIPA Buffer γιĮ την εξισορρόπηση της ριτίνης. o Κάθε πλύσιμο περιλĮμβάνει:

- Προσθήκη διĮλύμĮτος κĮι Įνάδευση με περιστροφή γιĮ 5min στους 4οC

- Φυγοκέντρηση γιĮ 1min στους 4oC στις 510xg.

5. Ακολουθεί πρόσδεση των Įντιδράσεων της πρωτεϊνης με τĮ κυττĮρικά εκχυλίσμĮτĮ στην Ni-NTA ριτίνη μέσω του 6xHis-tag, σύμφωνĮ με τις κĮτάλληλες συνθήκες.

Η πρόσδεση γίνετĮι με περιστροφή του δείγμĮτος με τη ριτίνη γιĮ 2 ώρες στους 4οC

- Η ποσότητĮ της πρωτεΐνης που επιθυμούμε νĮ προσδεθεί Įντιστοιχεί στĮ 20μg, ώστε νĮ υπάρχει η συγκεκριμένη πρωτεΐνη σε μεγάλη συγκέντρωση στο δείγμĮ μĮς.

- Συνήθως

6. Φυγοκεντρούμε γιĮ 5min στους 4oC στις 510xg, ώστε νĮ εκλουστεί το μη προσδεδεμένο μέρος της ĮντίδρĮσης.

- Απο το έκλουσμĮ κρĮτάμε δείγμĮ 15μl , προσθέτουμε 5μl 2x loading buffer κĮι φυλάσσουμε στους -20οC

7. ΠρĮγμĮτοποιούμε δέκĮ πλυσίμĮτĮ στην Ni- NTA ριτίνη με 10 όγκους ξηρού όγκου σφĮιριδίων με διάλυμĮ τροποποιημένου RIPA Buffer

o Κάθε πλύσιμο περιλĮμβάνει:

- Προσθήκη διĮλύμĮτος κĮι Įνάδευση με περιστροφή γιĮ 5min στους 4οC
- Φυγοκέντρηση γιĮ 1min στους 4oC στις 510xg.

8. Προσθέτουμε ίσο όγκο με τον ξηρό όγκο των σφĮιριδίων 2x SDS- loading buffer, το οποίο περιέχει DTT.

9. Βράζουμε τη ριτίνη γιĮ 5min στους 95οC

10. Φυγοκεντρούμε γιĮ 5min στους 4οC στις 13000rpm\

11. Φυλάσσουμε το δείγμĮ στους -20oC

12. ΤĮ δείγμĮτĮ μπορούν νĮ ĮνĮλυθούν σε SDS-PAGE με χρώση Įργύρου κĮι στη συνέχειĮ με ĮποτύπωμĮ κĮτά Western.

3. ΑΠΟΤΕΛΕΣΜΑΤΑ

Στόχος της συγκεκριμένης εργĮσίĮς ήτĮν η μελέτη του ολιγομερισμού κĮι οι ενδομοριĮκές Įλληλεπιδράσεις της πρωτεϊνης HURP κĮι κĮτ’επέκτĮση της λειτουργίĮς της. ΓιĮ το σκοπό Įυτό πρĮγμĮτοποιήθηκε έκφρĮση in vitro σε βĮκτηριĮκά στελέχη E.coli του Įμινο-τελικού τμήμĮτος κĮι του κĮρβοξυ- τελικού τμήμĮτος της πρωτεΐνης HURP. ΑκολούθησĮν πειράμĮτĮ κĮθίζησης (pull-down) σε μιτωτικά εκχυλίσμĮτĮ κυττάρων HeLa κĮι. Τέλος, κĮθώς είνĮι γνωστό βιβλιογρĮφικά Įλλά κĮι Įπο προηγούμενĮ πειράμĮτĮ στο

συγκεκριμένο εργĮστήριο, η πρωτεΐνη HURP φωσφορυλιώνετĮι κĮτĮ τη μίτωση Įπό την μιτωτική κινάση Aurora A , γεγονός που της επιτρέπει νĮ Įλληλεπιδρά με άλλες πρωτεΐνες κĮι νĮ συμμετέχει σε σύμπλοκο/Į πρωτεϊνών. Dzτσι έγινε η έκφρĮση της Aurora A in vitro ώστε νĮ χρησιμοποιηθεί σε πειράμĮτĮ κĮθίζησης σε μιĮ προσπάθειĮ νĮ φĮνεί τόσο ο ρόλος της Aurora A στη λειτουργείĮ της HURP ĮλλĮ κĮι στη μελέτη του συμπλόκου που σχημĮτίζετĮι.

Η HURP είνĮι χωρισμένη σε τρίĮ διĮκριτά τμήμĮτĮ μέσω του

προγράμμĮτος πρόβλεψης δευτεροτĮγούς δομής GLOBPLOT σύμφωνĮ με τις υποτιθέμενες δομικές περιοχές που προκύπτουν, Įφού η δομή της είνĮι Įκόμη άγνωστη. ΤĮ τμήμĮτĮ Įυτά είνĮι το άμινο-τελικό Ν, που περιλĮμβάνει τĮ πρώτĮ 300 Įμινοξικά κĮτάλοιπĮ (1-900bp), το ενδιάμεσο τμήμĮ Μ που ĮποτελείτĮι Įπό τĮ ĮμινοξέĮ 300-600 (898-1803bp) κĮι το κάρβοξυ-τελικό C με τĮ τελευτĮίĮ 246 ĮμινοξέĮ (1798-2538bp).

>Πλήρης Αμινοξική ĮλληλουχίĮ της πρωτεϊνης HURP  847 Įμινοξικά κĮτάλοιπĮ (aa) 5’-

MSSSHFASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKP RAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAEPKKAIPSSVRITRSK AKDQMEQTKIDNESDVRAIRPGPRQTSEKKVSDKEKKVVQPVMPTSLRMTRSATQAAKQVPRTVSSTTARKPVTRA ANENEPEGKVPSKGRPAKNVETKPDKGISCKVDSEENTLNSQTNATSGMNPDGVLSKMENLPEINTAKIKGKNSFAP KDFMFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLKTEVDESQATKEILAQKCKTYSTKTIQQDSNKLPCPLGPLT VWHEEHVLNKNEATTKNLNGLPIKEVPSLERNEGRIAQPHHGVPYFRNILQSETEKLTSHCFEWDRKLELDIPDDAKD LIRTAVGQTRLLMKERFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMN HNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPV KLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCP GLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQ NSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF* -3’

Abbildung in dieser Leseprobe nicht enthalten

ΠίνĮκĮς 3.1 Αποικʊνηση Χρήσηʎ αμινοξικών καταλοίπων (Amino Acid Usage) τηʎ πρωτεϊνηʎ ΗURP ʊπωʎ προκύπτει απο το πρʊγραμμα DNA Strider V 1.4f

Ωστόσο η in vitro έκφρĮση των Įρχικών τμημάτων της HURP δεν ήτĮν ικĮνοποιητική γεγονός που Įποδόθηκε στο οτι ο συγκεκριμένος διĮχωρισμός πĮρεμβĮίνει σε κάποιĮ δομική επικράτειĮ τηε πρωτεΐνης που τελικά επηρεάζει τη στĮθερότητĮ κĮι τη σωστή της ĮνĮδίπλωση. έτσι σχεδιάστηκĮν νέĮ Įμινοτελικά, κĮρβοξυτελικά κĮι ενδιάμεσĮ τμήμĮτĮ τμήμĮτĮ:

- Ν1 το οποίο περιλĮμβάνει τĮ πρώτĮ 218 ĮμινοξέĮ (1-654bp)  Ν2, το οποίο περιλĮμβάνει τĮ πρώτĮ 265 κĮτάλοιπĮ (1-795bp)  Το μέσο τμήμĮ Μ1 που ĮποτελείτĮι Įπό τĮ τĮ ĮμινοξέĮ 306-611 (916-1833bp)
- Το κĮρβοξυτελικό άκρο C1 που ĮποτελείτĮι Įπό τĮ τελευτĮίĮ 180 ĮμινοξέĮ (2002-2541bp)

Το γονίδιο της hHURP όπως κĮι τĮ τμήμĮτά της Ν, Μ, C είνĮι κλωνοποιημένĮ στο φορέĮ pET28d (Φορείς κλωνοποίησης-§2.1.2) που φέρει δύο tags 6xHis κĮι GST, ενώ τĮ ίδιĮ τμήμĮτĮ βρίσκοντĮι κλωνοποιημένĮ κĮι στο φορέĮ pT7- 7 (Φορείς κλωνοποίησης-§2.1.2), Įφού στο γονίδιο έχει ενσωμĮτωθεί Įνοδικά το 6xHis tag. Αντιθέτως, τĮ τμήμĮτĮ Ν1 κĮι Ν2 κλωνοποιήθηκĮν στο φορέĮ pET28a (Φορείς κλωνοποίησης-§2.1.2) κĮι φέρουν μόνο 6xHis tag στο άμινο- τελικό τους άκρο. Εν τέλει, το γονίδιο της Aurora A έχει ĮνĮσυνδυĮστεί με το φορέĮ pET21d (Φορείς κλωνοποίησης-§2.1.2) κĮι φέρει στο κĮρβόξυ- τελικό του άκρο 6xHis tag.

Η συγκεκριμένη μελέτη επικεντρώνετĮι στην κλωνοποίηση κĮι έκφρĮση του N2 κĮι στην in vitro έκφρĮση του C τμήμĮτος. Η κλωνοποίηση του C τμήμĮτος σε φορέĮ pT7-7 (Φορείς κλωνοποίησης-§2.1.2) είχε ήδη προηγηθεί.

ΤμήμĮ Ν2 (795bp ή 265 aa).

Abbildung in dieser Leseprobe nicht enthalten

Πʀνακας 3.2 Αποικʊνηση Χρήσηʎ αμινοξικών καταλοίπων (Amino Acid Usage) του Ν2 τμήματοʎ τηʎ πρωτεϊνηʎ ΗURP ʊπωʎ προκύπτει απο το πρʊγραμμα DNA Strider V 1.4f

ΤμήμĮ C (246 ĮμινοξȑĮ που Įντιστοιχούν στĮ ζεύγη βάσεων 1798- 2538bp).

Abbildung in dieser Leseprobe nicht enthalten

Πʀνακας 3.3 Αποικʊνηση Χρήσηʎ αμινοξικών καταλοίπων (Amino Acid Usage) του C τμήματοʎ τηʎ πρωτεϊνηʎ ΗURP ʊπωʎ προκύπτει απο το πρʊγραμμα DNA Strider V 1.4f

Η έκφρĮση του τμήμĮτος N2 κĮι C πρĮγμĮτοποιήθηκε στο βĮκτηριĮκό στέλεχος του E.coli BL21 Star DE3 pRARE2 (ΒĮκτηριĮκά στελέχη του E.coli- §2.1.1), ενώ γιĮ την έκφρĮση της Aurora A χρησιμοποιήθηκε το βĮκτηριĮκό στέλεχος Rosetta DE3 pLysS (ΒĮκτηριĮκά στελέχη του E.coli-§2.1.1). Το στέλεχος BL21 Star DE3 pRARE2 χρησιμοποιήθηκε διότι περιέχει επτά σπάνιĮ κωδικόνιĮ, τĮ οποίĮ δεν πĮράγοντĮι Įπό το E.coli, κĮι γι’ Įυτό το λόγο είνĮι το κĮτĮλληλότερο γιĮ in vitro έκφρĮση ευκĮρυωτικών πρωτεϊνών που περιλĮμβάνουν Įυτά τĮ κωδικόνιĮ. Από την άλλη, το στέλεχος Rosetta DE3 pLysS πĮρέχει έξι σπάνιĮ κωδικόνιĮ κĮι το γονίδιο που κωδικοποιεί γιĮ την Τ7 λυσοζύμη, οπότε είνĮι κĮτάλληλο γιĮ in vitro έκφρĮση ευκĮρυωτικών πρωτεϊνών τοξικών ή όχι γιĮ τĮ βĮκτήριĮ.

Η Įπομόνωση κĮι ο κĮθĮρισμός των πρωτεϊνών που φέρουν το 6xHis tag πρĮγμĮτοποιήθηκε με τη χρήση της ρητίνης μετĮλλικής συγγένειĮς Protino Ni- TED Resin γιĮ δοκιμές μικρής κλίμĮκĮς ενώ γιĮ μεγάλης κλίμĮκĮς κĮθĮρισμούς χρησιμοποιήθηκε η κολώνĮ μετĮλλικής συγγένειĮς High Trap Chelating Column 5ml. ΚĮι οι δύο λειτουργούμε με βάση την ίδιĮ Įρχή. Δίνουν τη δυνĮτότητĮ γιĮ την Įπομόνωση κĮι κĮθĮρισμό ĮνĮσυνδυĮσμένων πρωτεϊνών που φέρουν tag-πολυιστιδινών μέσω χρωμĮτογρĮφίĮς συγγένειĮς Įκινητοποιημένων μετĮλλικών ιόντων (IMAC). Η συγκεκριμένη έχει ĮκινητοποιημένĮ ιόντĮ Ni[2]++ τĮ οποίĮ Įλληλεπιδρούν με τις ιστιδίνες. Ο χηλικός πĮράγοντĮς του Ni[2]++ που χρησιμοποιείτĮι στην Ni-TED ρητίνη, είνĮι TED (tris-carboxymethyl ethylene diamine) που σχημĮτίζει πέντε δεσμούς με το ιόν Ni[2]++, Įπό τις έξι θέσεις πρόσδεσης που έχει (εικόνĮ 3.1). Dzτσι, είνĮι ελεύθερη μίĮ θέση πρόσδεσης γιĮ νĮ Įλληλεπιδράσει με την 6xHis-tag. Με Įυτό τον τρόπο, ĮυξάνετĮι η ειδικότητĮ της πρόσδεσης στη ρητίνη κĮι ελĮχιστοποιούντĮι οι μη ειδικές προσδέσεις που οφείλοντĮι στον πλεονĮσμό διĮθέσιμων μετĮλλικών ιόντων .

Abbildung in dieser Leseprobe nicht enthalten

Protino® Ni-NTA Agarose, Mecheray-Nagel manual

ΕικονĮ 3.1 ΣχημĮτική Įπεικόνηση πρόσδεσης 6XHis-tag ĮνĮσυνδυĮσμȑνης πρωτεϊνης σε ριτίνη Protino ® Ni-TED.

A. ΣφĮιρίδιο οξείδιου της σιλικόνης (με χημικό τύπο SiO2), που φέρει τον μετĮλλικό χηλικό πĮράγοντĮ που έχει προσδεδεμένο ενĮ δισθενές κĮτιόν Ni[2]++ .

B. ΕνĮ κĮτάλοιπο ιστιδίνης (Įπο τĮ 6 του 6X His-tag) προσδένετĮι στη ριτίνη.

ΑντίθετĮ, η ρητίνη Ni-NTA που έχει η στήλη Ni-NTA HighTrap Chelating Protein 5ml της GE Healthcare που χρησιμοποιείτĮι γιĮ κĮθĮρισμό μεγĮλης κλίμĮκĮς με FPLC, σχημĮτίζει τέσσερις δεσμούς με το Ni2+ .Αυτό σημĮίνει οτι υπάρχουν δύο ελεύθερες θέσεις γιĮ νĮ Įλληλεπιδράσουν με δύο κοντινές ιστιδίνες σε ένĮ 6XHis -tag.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.2 ΣφĮιρίδιο ĮγĮρόζης που φέρει τον χηλικό πĮράγοντĮ ΝΤΑ (NitriloTriAcetic Acid) οποίος σχημĮτίζει ισχυρό δεσμό με τεσσερεις Įπο τις 6 θέσεις πρόσδεσης του δισθενούς κĮτιόντος Νικελίου

ǵλες οι πρωτεϊνες που χρησιμοποιήθηκĮν είχĮν 6XΗis -tag είτε στο Įμινο-τελικό είτε στο κĮρβόξυτελικό άκρο τους κĮι έτσι όλες περιλĮμβάνουν ένĮ βήμĮ κĮθĮρισμού με κάποιĮ Įπο τις ριτίνες Ni-TED ή Ni-NTA. Πρωτεΐνες σε φορέĮ έκφρĮσης pET28d (ενότητĮ 2.1.2) έχουν δίπλĮ Įπο την ĮλληλουχίĮ -ετικέτĮ 6XHis-tag κĮι ένĮ GST-tag. ΓιĮ το κĮθĮρισμό τέτοιων πρωτεΐνων είνĮι κĮτάλληλη κĮι η Glutathione Sepharose 4B. Αυτή η σεφĮρόζη έχει προσδεδεμένη τη γλουτĮθειόνη, η οποίĮ Įλληλεπιδρά με την τρĮνσφεράση S της γλουτĮθειόνης (GST), κĮι έτσι είνĮι δυνĮτή η πρόσδεση τέτοιου είδους πρωτεϊνών Įπό το υπερκείμενο μετά τη λύση του κυττĮρικού ιζήμĮτος.

ΓιĮ την Įπομόνωση του συμπλόκου των τμημάτων N2 κĮι C γίνετĮι χρήση στήλης μοριĮκής διήθησης. (ΧρωμĮτογρĮφίĮ ΜοριĮκής ∆ιήθησης (μοριĮκού Įποκλεισμού) - Size exclusion chromatography). Η πηκτή είνĮι πορώδης κĮι δεν Įλληλεπιδρά με τη πρωτεϊνη. ΣχημĮτίζει δĮιδĮλώδεις διĮδρομές Įπο τις οποίες διέρχοντĮι οι πρωτεϊνες κĮι ο διĮχωρισμός τους γίνετĮι μόνο βάση μοριĮκού μεγέθους . Οι μεγĮλύτερου μεγέθους πρωτεΐνες δεν χωρούν στους μικρότερης διĮμέτρου πόρους της ππηκτής κĮι εκλούοντĮι τĮχύτερĮ. ΕνδιάμεσĮ μεγέθους μόριĮ εκλούοντĮι με ενδιάμεση τĮχύτητĮ ενώ τĮ μικρότερĮ μόριĮ που διέρχοντĮι Įπο κάθε πόρο της πηκτής κĮθυστερούν νĮ εκλουστούν.

Abbildung in dieser Leseprobe nicht enthalten

ΕικόνĮ 3.3. ΣχημĮτική ĮνĮπĮράστĮση ΧρωμĮτογρĮφίĮς SEC . ΤĮ μεγĮλύτερĮ μόριĮ δεν διέρχοντĮι στους πόπους τις πηκτής κĮι έκλούοντĮι πρώτĮ ενώ τĮ μικρότερĮ μόριĮ εκλούοντĮι τελευτĮίĮ. ΦĮίνετĮι κĮι ο νεκρός όγκος της στήλης (ǵγκος στήλης Vo)

ΜεγάλĮ μόριĮ που δεν εισέρχοντĮι στη πηκτή εκλούοντĮι στον ǵγκο Στήλης (void volume, Vo )κĮι με την ίδιĮ τĮχύτητĮ με τη τĮχύτητĮ ροής του διĮλύμĮτος. Ο όγκος Įυτός εισούτĮι με την κινητή φάση της στήλης κĮι Įντιστοιχεί στο 30% του συνολικού όγκου της στήλης .

ΓιĮ περετĮίρω κĮθĮρισμό των πρωτεϊνών pET28a/N2 κĮι pT7-7/C Χρησιμοποιήθηκε υγρή ΧρωμĮτογρĮφίĮ ΙοντοĮντĮλλĮγής.

Ο διĮχωρισμός των συστĮτικών επιτυγχάνετĮι με εκλεκτικές δεσμεύσεις κĮι Įποδεσμεύσεις μετĮξύ των ιονισμένων συστĮτικών ενός υγρού κĮι μιĮς στερεάς στĮτικής φάσης (ρητίνης) που φέρει δρĮστικές ομάδες στις οποίες συνδέοντĮι ευκίνητĮ ιόντĮ που μπορούν νĮ ĮντĮλλĮγούν με τĮ ιόντĮ του υγρού.

ΤĮ προς διĮχωρισμό συστĮτικά του μίγμĮτος βρίσκοντĮι σε ιοντική μορφή με Įντίθετο φορτίο ως προς τη στĮτική φάση κĮι έλκοντĮι σ’ Įυτήν με ηλεκτροστĮτικές δυνάμεις Η κινητή φάση είνĮι υγρή.

Η χĮρĮκτηριστική ομάδĮ που περιέχει τĮ προς ĮντĮλλĮγή ιόντĮ προσδιορίζει τĮ χĮρĮκτηριστικά της ρητίνης.

Abbildung in dieser Leseprobe nicht enthalten

- Ρητίνες που μπορούν νĮ ĮντĮλλάξουν τĮ κĮτιόντĮ τους με κĮτιόντĮ του περιβάλλοντος ονομάζοντĮι κĮτιοντĮλλĮκτικές

- Ρητίνες που μπορούν νĮ ĮντĮλλάξουν τĮ ĮνιόντĮ τους με ĮνιόντĮ του περιβάλλοντος ονομάζοντĮι

Abbildung in dieser Leseprobe nicht enthalten

ĮνιοντĮλλĮκτικές

Στη πĮρούσĮ μελέτη χρησιμοποιήθηκε η ριτίνη ΚĮτιοντιĮντĮλλĮγής Mono Q Uno της ΒιοRAd κĮι ώς ριτίνη ΑνιοντοĮντĮλλĮκτική χρησιμοποιήθηκε η SP Sepharose Fast Flow της GE Healthcare. Η πρόσδεση εξĮρτάτĮι Įπο το φορτίο της πρωτεϊνης που Įποκτά στο εκάστοτε διάλυμĮ ĮνάλογĮ με το pH του διĮλύμĮτος κĮι η συσχέτιση του με το ισοηλεκτρικό σημείο της πρωτεΐνης (pI). Αν το pΗ του διĮλύμĮτος εινĮι μεγĮλύτερο του pI της πρωτεΐνης τότε Įυτή θĮ είνĮι Įρνητικά φορτισμένη στο συγκεκριμένο διάλυμĮ. Αν ĮντίθετĮ το pH είνĮι μικρότερο του pI, η πρωτεΐνη φορτίζετĮι θετικά.

Abbildung in dieser Leseprobe nicht enthalten

Καμπύλη εκλουσηʎ μη Εκλουση μορίων ͘ Πρώτα μʊρια μεμκρʊτερη συγγένεια προσδεδεμένων μορίων Φορτίου, έπειτα μʊρια με μʊρια με μεγɳλη συγγενεια φορτίου

ΕικόνĮ 3.4 ΣχημĮτική κĮι διĮγρĮμμĮτική ĮνĮπĮράστĮση ΑνιοĮντĮλλĮκτικής Στήλης.

ΓιĮ τον έλεγχο της στĮθερότητĮς των πρωτεϊνών στĮ διάφορĮ διĮλύμĮτĮ πρĮγμĮτοποιήθηκε σάρωση DSF .

3.1 Εύρεση συνθηκών in vitro ȑκφρĮσης, Įπομόνωσης κĮι

στĮθερότητĮς των πρωτεϊνικών τμημάτων 6XHis-Ν2 κĮι 6XHis-C (\ σε βĮκτηριĮκό στȑλεχος E.Coli BL21 Star DE3 pRARE2 .

3.1.1 Άμινο-τελικό άκρο 6XHis-Ν2

ΓιĮ την έκφρĮση του τμήμĮτος Įυτού χρησιμοποιήθηκε το βĮκτηριĮκό στέλεχος BL21 Star DE3 pRARE2 κĮι η επĮγωγή δοκιμάστηκε με την προσθήκη 0.5mM IPTG κĮι 1mM IPTG τόσο γιĮ διάρκειĮ επĮγωγής 3.5 h στους 25οC όσο κĮι διάρκειĮ επĮγωγής 5.5h στους 25οC (εικόνĮ 3.5.1 κĮι 3.5.2) . Στη συνέχειĮ, γιĮ την επĮνĮδιάλυση του κυττĮρικού ιζήμĮτος χρησιμοποιήθηκε το διάλυμĮ επĮνĮδιάλυσης (Resuspension Buffer).

ΚĮλύτερη έκφρĮση φάινετĮι νĮ έχει η επĮγωγή με 0.5mM IPTG γιĮ 3.5 h στους 25oC( εικόνĮ 3.5.1).

ΓιĮ την Įπομόνωσή του N2 που εκφράστηκε με τις συνθήκες Įυτές χρησιμοποιήθηκε η ριτίνη Protino Ni-TED Resin κĮι τĮ διĮλύμĮτĮ πλύσης (Wash Buffer) κĮι έκλουσης (Elution Buffer). Επίσης, πρĮγμĮτοποιήθηκε διĮπίδυση με το διάλυμĮ Dialysis Buffer.

Η έκφρĮση του τμήμĮτος 6xHis-Ν2 δίνει μιĮ Įρκετά ικĮνοποιητική ποσότητĮ διĮλυτής πρωτεΐνης στο υπερκείμενο του κυττĮρικού εκχυλίσμĮτος, Įφού Įποδίδει 75μg/50ml κĮλλιέργειĮ άρĮ 1.5mg πρωτεΐνης σε 1 L κĮλλιέργειĮς (εικόνĮ 3.5.1).

Η πρόσδεση είνĮι εξίσου ικĮνοποιητική. Η έκλουση με τη υψηλότερη συγκέντρωση της κĮθĮρής πρωτεΐνης είνĮι ~25μg κĮι πĮρĮτηρείτĮι πως έχει ĮπομĮκρυνθεί το μεγĮλύτερο μέρος των μη ειδικών προσδέσεων Ωστόσο μεγάλο μέρος της πρωτεΐνης πĮρĮμένει προσδεδεμένο στη ριτίνη (εικόνĮ 3.6). DzπειτĮ, πρĮγμĮτοποιήθηκε συγκέντρωση των εκλουσμάτων 1,2 κĮι 3 σε κολώνες Viva Spin 500 κĮι στη συνέχειĮ διĮπίδυση με το διάλυμĮ Dialysis Buffer, στο οποίο το τμήμĮ Ν2 είνĮι στĮθερό (εικόνĮ 3.7).

ΔΙΑΛΥΜΑΤΑ

Abbildung in dieser Leseprobe nicht enthalten

- Στο διάλυμĮ επĮνĮδιάλυσης η λυσοζύμη προστίθετĮι ωστε νĮ υποβοηθήσει τη λύση των κυττĮρικών τοιχωμάτων, ενώ οι ĮνĮστολείς πρωτεĮσών σερίνης/θρεονίνης PMSF προστίθεντĮι γιĮ την προστĮσίĮ της πρωτεΐνης Įπό Įποικοδόμηση.
- Το ιμιδĮζόλιο προστίθετĮι στο διάλυμĮ της έκλουσης κĮθώς είνĮι Įυτό που ĮντĮγωνίζετĮι τις έξι ιστιδίνες γιĮ την πρόσδεση στĮ ιόντĮ Ni2+ της ρητίνης.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.5.1. SDS-PAGE Įνάλυση της έκφρĮσης του Įμινοτελικού τμήμĮτος Ν2 (1-246 Įμινοξικά κĮτάλοιπĮ) σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 3.5 ώρες στους 25οC με 0.5mM IPTG κĮι 1mM IPTG

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.5.2. SDS-PAGE Įνάλυση της έκφρĮσης του Įμινοτελικού τμήμĮτος Ν2 (1-246 Įμινοξικά κĮτάλοιπĮ) σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 5.5 ώρες στους 25οC με 0.5mM IPTG κĮι 1mM IPTG

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.6. SDS-PAGE Įνάλυση του κĮθĮρισμού του Įμινοτελικού τμήμĮτος Ν2 (1-246 Įμινοξικά κĮτάλοιπĮ) με ριτίνη Ni-TED το οποίο έχει εκφρĮστεί σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 3.5 ώρες στους 25οC με 0.5mM IPTG.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.7 SDS-PAGE Įνάλυση της συγκέντρωσης κĮι της διĮπίδυσης του Įμινοτελικού τμήμĮτος Ν2 (1-246 Įμινοξικά κĮτάλοιπĮ) το οποίο έχει εκφρĮστεί σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 3.5 ώρες στους 25οC με 0.5mM IPTG.

Ακολούθησε επιβεβĮιωτική έκφρĮση μεγάλης κλίμĮκĮς (1L). Οι συνθήκες Įυτές είνĮι κĮτάλληλες κĮι γιĮ τη κρυστάλλωση της πρωτεΐνης, εφόσον Įποδίδουν ικĮνοποιητική έκφρĮση κĮι κĮθĮρότητĮ (purity) . Ο κĮθĮρσμός Įυτή τη φορά πρĮγμĮτοποιήθηκε σε μηχάνημĮ FPLC με κολώνĮ Ni-NTA High Trap Chelating Protein Column 5ml (διάγράμμĮτĮ 3.1, 3.2, 3.3). H πρωτεΐνη στάλθηκε κĮι γιĮ CD( Circular Dichroism) μĮζί με τη πρωτεΐνη 6ΧHis-tag C γιĮ διĮπίστωση κĮι Įνάλυση της ĮλληλεπίδρĮση τους (τĮ δεδομένĮ δεν πĮρουσιάζοντĮι) . Η μεγάλης κλίμĮκĮς έκφρĮση Įπέδωσε τελικά (μετά κĮι τη διĮπίδυση ) 2.2mg πρωτεΐνης (εικονĮ 3.10)

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.8. SDS-PAGE Įνάλυση της έκφρĮσης του Įμινοτελικού τμήμĮτος Ν2 (1-246 Įμινοξικά κĮτάλοιπĮ) σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 3.5 ώρες στους 25οC με 0.5mM IPTG

Abbildung in dieser Leseprobe nicht enthalten

ΔιĮγράμμĮτĮ 3.1 κĮι 3.2 . Αριστερά, μη προσδεδεμένες πρωτεΐνες κĮι δεξιά έκλουσμĮ πλύσης με ΔιάλυμĮ Πλύσης (wash Buffer)

Abbildung in dieser Leseprobe nicht enthalten

ΔιάγρĮμμĮ 3.3 ΔιάγρĮμμĮ FPLC (method 9). Dzκλουση του τμήμĮτος Ν2 με κλίση συγκέντρωσης ΙμιδĮζολίου

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.9.SDS-PAGE Įνάλυση του κĮθĮρισμού του Įμινοτελικού τμήμĮτος Ν2 (1-246 Įμινοξικά κĮτάλοιπĮ) με ριτίνη Ni-ΝΤΑ σε μηχάνημĮ FPLC το οποίο έχει εκφρĮστεί σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 3.5 ώρες στους 25οC με 0.5mM IPTG.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.10 SDS-PAGE Įνάλυση της συγκέντρωσης κĮι της διĮπίδυσης του Įμινοτελικού τμήμĮτος Ν2 (1-246 Įμινοξικά κĮτάλοιπĮ) το οποίο έχει εκφρĮστεί σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 3.5 ώρες στους 25οC με 0.5mM IPTG.

Επιχειρήθηκε κĮι ο περĮιτέρω κĮθĮρισμός της πρωτεϊνης υπο μη

ĮποδιĮτĮκτικές με χρήση υγρής χρωμĮτĮογρĮφίĮς ιοντοĮντĮλλĮγής. Εφόσον το pI του τμήμĮτος Ν2 είνĮι 11.02 (πίνĮκĮς 2), σε pH 7.5 του διĮλύμĮτος η πρωτΐνη θĮ είνĮι θετικά φορτισμένη. Επομένως η πρόσδεση της επιχειρείτĮι σε στήλη κĮτιοντοĮντĮλλĮγής με ριτίνη SP sepharose Fast Flow. Ωστόσο η πρόσδεση είνĮι Įνεπιτυχής

3.1.2 ΚĮρβοξυτελικό-τελικό άκρο 6XHis-C

Το κĮρβόξυ-τελικό τμήμĮ της HURP στο συγκεκριμένο φορέĮ κλωνοποίησης (pT7-7/C) φέρει 6XHis- tag κĮι είχε προηγουμένως εκφρĮστεί κĮι κĮθĮριστεί με μη- ĮποδιĮτĮκτικές συνθήκες, ωστόσο μη ικĮνοποιητικĮ. Dzγινε η υπόθεση οτι η πρωτεΐνη πĮρĮμένει πĮγιδευμένη στο ίζημĮ των κυττάρων , σχημĮτίζοντĮς έγκλειστĮ σωμάτιĮ (inclution bodies) . Dzτσι το πρωτόκολλο έκφρĮσης τροποποιήθηκε κĮι έγινε Įπομόνωση πρωτεΐνης Įπο ίζημĮ κυττάρων με ĮποδιĮτĮκτικές συνθήκες. Η επĮγωγή της έκφρĮσης έγινε με 1mM IPTG υπο Įνάδευδη (200rpm) στους 25οC γιĮ 3.5h. το διάλυμĮ επĮνĮδιάλυσης τροποποιήθηκε ωστε νĮ είνĮι ĮποδιĮτĮκτικό , με τη προσθήκη 6M ουρίĮς (Urea) (εικόνĮ 3.11). Ο κĮθĮρισμός έγινε με FPLC ενώ η Įπομάκρυνση της ουρίĮς γιĮ την επĮνĮδιάτĮξη της πρωτεΐνης έγινε εφόσον η πρωτεΐνη ήτĮν προσδεδεμένη στη κολώνĮ χρωμĮτογρĮφίĮς, με δημιουργίĮ Įρνητικής κλίσης συγκέντρωσης της ΟυρίĮς (6Μ  0Μ) μετĮξύ του διĮλύμĮτος επĮνĮδιάλυσης(Resuspension Buffer) κĮι του διĮλύμĮτος επĮνĮδίπλωσης (Refolding Buffer) (διĮγράμμĮτĮ 3.5, 3.6, 3.7).

Δοκιμάστηκε επίσης η επĮγωγή της έκφρĮσης γιĮ 2h στους 37oC με 1mM IPTG με τη λογική νĮ προωθηθεί ο σχημĮτισμός inclution bodies.

Επίσης δοκιμάστηκε η έκλουση Įπο την Ni-NTA κολώνĮ πĮρουσίĮ ουρίĮς κĮι άρĮ υπο ĮποδιĮτĮκτικές συνθήκες (ΔιάγρĮμμĮ 3.4) .Η πρωτεΐνη εκλούοντĮν συνεχώς. Επομένως εκλούετĮι ĮρĮιή κĮι μάλιστĮ με μικρότερη κĮθĮρότητĮ. Η επĮνĮδίπλωση σε Įυτή τη περίπτωση έγινε με στĮδιĮκή διĮπίδυση (step dialysis) .

Τελικά επιλέχθηκε το πρωτόκολλο που υποδεικνύει την ĮνĮδίπλωση της πρωτεΐνης επι της κολώνĮς γιĮτί είχε τη βέλτιστη Įπόδοση πρωτεΐνης σε συνδυĮσμό με το βέλτιστο επίπεδο κĮθĮρότητĮς.

Η ποσότητĮ της πρωτεϊνης Įυξήθηκε σημĮντικά (4mg/L κĮλλιέργειĮς)(εικόνĮ 3.11) ενώ το ίδιο συνέβη κĮι στη κĮθĮρότητĮ της όπως έινĮι φĮνερό με τη σύγκριση των εικόνων 3.14 κĮι 3.15. Ακολούθησε διĮπίδυση γιĮ την Įπομάκρυνση κĮι του ιμιδĮζολίου κĮι η πρωτεΐνη Įποδείχθηκε στĮθερή.

Η έκλουση της πρωτεΐνης δοκιμάστηκε κĮι με διĮλύμĮτĮ τĮ οποίĮ περιείχĮν 150mM ΝaCl (τελική συγκέντρωση άλĮτος 287mM ) (τĮ δεδομένĮ δεν πĮρουσιάζοντĮι ) . Η πρωτεΐνη ήτĮν κĮι πάλι στĮθερή.

Τελικός στόχος όμως της Įπομόνωσης της ήτĮν η ĮλληλεπίδρĮση της με το Įμινοτελικό τμήμĮ Ν2. Dzτσι χρησιμοποιήθηκĮν διĮλύμĮτĮ με 300mM επιπλέον NaCl ( τελική συγκέντρωση άλĮτος 437mM) ωστε τĮ δυο τμήμĮτĮ της HURP νĮ βρίσκοντĮι τελικά στο ίδιο διάλυμĮ κĮι νĮ διευκολυνθεί η ĮντίδρĮση ĮλληλεπίδρĮσής τους.

ΔΙΑΛΥΜΑΤΑ

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.11. SDS-PAGE Įνάλυση της έκφρĮσης του κĮρβόξυτελικού τμήμĮτος C (601-8467

Įμινοξικά κĮτάλοιπĮ) σε BL21 Star DE3 pRARE2 βĮκτηριĮκά κύττĮρĮ με επĮγωγή διάρκειĮς 3.5 ώρες στους 25οC με 1mM IPTG κĮι με πρωτόκολλο Įπομόνωσης πρωτεϊνης Įπο κυττĮρικό ίζημĮ υπο ĮποδιĮτĮκτικές συνθήκες.

Abbildung in dieser Leseprobe nicht enthalten

ΔιάγρĮμμĮ 3.4. ΚĮθĮρισμός πρωτεΐνης 6XHis/C με FPLC υπο ĮποδιĮτĮκτικές συνθήκες. Η πρωτεϊνη εκλούετĮι συνεχώς.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.12.1 SDS-PAGE Įνάλυση του κĮθĮρισμού του κĮρβόξυτελικού τμήμĮτος C (601-847) Įμινοξικά κĮτάλοιπĮ) με ριτίνη Ni-ΝΤΑ σε μηχάνημĮ FPLC.

Λωρȓδα 1: Πρωτεȧνικος Μαρτυρας Μοριακȫν Βαρȫν Smart Broad-Range Protein Standard (5μl)

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.12.2.SDS-PAGE Įνάλυση του κĮθĮρισμού του κĮρβόξυτελικού τμήμĮτος C (601- 847) Įμινοξικά κĮτάλοιπĮ) με ριτίνη Ni-ΝΤΑ σε μηχάνημĮ FPLC υπο ĮποδιĮτĮκτικές συνθήκες πĮρουσίĮ ουρίĮς

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.12.3.SDS-PAGE Įνάλυση του κĮθĮρισμού του κĮρβόξυτελικού τμήμĮτος C (601- 847) Įμινοξικά κĮτάλοιπĮ) με ριτίνη Ni-ΝΤΑ σε μηχάνημĮ FPLC υπο ĮποδιĮτĮκτικές συνθήκες πĮρουσίĮ ουρίĮς.

Abbildung in dieser Leseprobe nicht enthalten

ΔιάγρĮμμĮ 3.5 ΚĮθĮρισμός της 6ΧΗis/C πρωτεΐνης με FPLC . Μη προσδεδεμένες πρωτεΐνες κĮι πλύση με Wash Buffer (+6M ουρίĮ)

Abbildung in dieser Leseprobe nicht enthalten

ΔιάγρĮμμĮ 3.6 ΚĮθĮρισμός της 6ΧΗis/C πρωτεΐνης με FPLC . Κλίση συγκέντρωσης ουρίĮς Įπο 6Μ ως 0Μ (ĮνĮδίπλωση πρωτεΐνης).

Abbildung in dieser Leseprobe nicht enthalten

ΔιάγρĮμμĮ 3.7 ΚĮθĮρισμός της 6ΧΗis/C πρωτεΐνης με FPLC . Κλίση συγκέντρωσης ιμιδĮζολίου (Dzκλουση πρωτεΐνης).

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.13.1 .SDS-PAGE Įνάλυση του κĮθĮρισμού του κĮρβόξυτελικού τμήμĮτος C (601-847) Įμινοξικά κĮτάλοιπĮ) με ριτίνη Ni-ΝΤΑ σε μηχάνημĮ FPLC.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.13.2 .SDS-PAGE Įνάλυση του κĮθĮρισμού του κĮρβόξυτελικού τμήμĮτος C (601-847) Įμινοξικά κĮτάλοιπĮ) με ριτίνη Ni-ΝΤΑ σε μηχάνημĮ FPLC

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.14 SDS-PAGE Įνάλυση της συγκέντρωσης κĮι της διĮπίδυσης του κĮρβοξυτελικού τμήμĮτος C (601-847 Įμινοξικά κĮτάλοιπĮ) το οποίο έχει Įπομονωθεί Įπο κυττĮρικό ίζημĮ με ĮποδιĮτĮκτικές συνθήκες κĮι έχει επĮνĮδιπλωθεί επι της Ni-NTA στήλης κĮτĮ το κĮθĮρισμό της με FPLC.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.15 SDS-PAGE Įνάλυση της συγκέντρωσης κĮι της διĮπίδυσης του κĮρβοξυτελικού τμήμĮτος C (601-847 Įμινοξικά κĮτάλοιπĮ) το οποίο έχει εκφρĮστεί με μη ĮποδιĮτĮκτικές συνθήκες κĮτĮ το τρόπο που περιγράφηκε στο Įμινοτελικό άκρο Ν2.

Επιχειρήθηκε περĮιτέρω κĮθĮρισμός της πρωτεϊνης υπο ĮποδιĮτĮκτικές (διάγρĮμμĮ 3.8) συνθήκες με χρήση υγρής χρωμĮτĮογρĮφίĮς ιοντοĮντĮλλĮγής. Εφόσον το pI του τμήμĮτος C είνĮι 4.89 (πίνĮκĮς 3), σε pH 7.5 του διĮλύμĮτος η πρωτΐνη θĮ είνĮι Įρνητικά φορτισμένη. Επομένως η πρόσδεση της επιχειρείτĮι σε στήλη ĮνιοντοĮντĮλλĮγής Uno Q της BioRad. Ωστόσο η πρόσδεση είνĮι Įνεπιτυχής (διάγρĮμμĮ 3.8) .

Abbildung in dieser Leseprobe nicht enthalten

Διɳγραμμα 3.8. Υγρή Χρωματογραφία ανιοντοανταλλαγήʎ τηʎ πρωτεʂνηʎ 6XHis/C υπο αποδιατακτικέʎ συνɽήκεʎ παρουσία ουρίαʎ και σε pH 7͘5͘ Η πρωτεϊνη δεν προσδένεται στη στήλη͘

Δοκιμή Σάρωσης DSF

Η δοκιμή σάρωσης DSF έγινε γιĮ νĮ διĮπιστωθεί η Įντοχή της πρωτεΐνης πĮρουσίĮ χĮμηλής ĮλĮτότητĮς υπο ĮποδιĮτĮχτικές συνθήκες κĮι σε pH 9.0. Η σύγκριση γίνετĮι με μη ĮποδιĮτĮχτικές συνθήκες ενώ ĮντίδρĮση ελέγχου Įποτελέι η ĮντίδρĮση 5. Σκοπός ήτĮν o έλεγχος της στĮθερότητĮς της πρωτεΐνης υπο συνθήκες γιĮ τη πρĮγμĮτĮτοποίηση υγρής χρωμĮτογρĮφίĮς ĮνιοντοĮντĮλλĮγής. Επειδή η πρόσδεση σε στήλη ĮνιοντοĮντĮλλĮγής δεν ήτĮν δυνĮτή (ΔιάγρĮμμĮ 3.8), δοκιμάστηκε η μείωση της ĮλĮτότητĮς του διĮλύμĮτος τηε προτεΐνης κĮθώς κĮι η Įύξηση του pH ωστε νĮ φορτιστεί ĮκόμĮ πιο πολύ.

Ενώ Įπο τη σάρωση DSF προκύπτει οτι η πρωτεΐνη πĮρĮμένει Įρκετά στĮθερή τόσο σε ĮποδιĮτĮκτικές όσο σε μη ĮποδιĮτĮκτικές συνθήκες, στη πράξη η πρόσδεση σε στήλη ĮνιοντοĮντĮλλĮγής δεν ήτĮν κĮι πάλι ικĮνοποιητική ενώ τĮ εκλούσμĮτĮ δεν περιείχĮν κĮθĮρότερο κλάσμĮ πρωτεϊνης. ΤονίζετĮι οτι υπάρχει διĮφορά μετĮξύ ĮποδιάτĮξης κĮι κĮτĮκρίμνησης της πρωτεΐνης. ΜιĮ ĮποδιετĮγμένη πρωτεϊνη (πχ με πĮρουσίĮ ουρίĮς) μπορεί νĮ ĮποστĮθεροποιείτĮι σε κάποιο διάλυμĮ κĮι νĮ κĮτĮκριμνίζετĮι.Το κĮρβοξυτελικό κλάσμĮ C εκλούοντĮν μĮζί με τις υπόλοιπες ζώνες(τĮ δεδομένĮ δεν πĮρĮτίθεντĮι).

Dzτσι δεν επιτεύχθηκε περĮιτέρω κĮθĮρισμός του τμήμĮτος C Įλλά η κĮθĮρότητĮ που επιτυγχĮνετĮι Įπο την Įπομόνωση του Įπο το κυττĮρικό ίζημĮ κĮι τον κĮθĮρισμό του με Ni-NTA στήλη είνĮι Įρκετά ικĮνοποιητική.

Αντιδράσεις

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.16. ΚĮμπύλη DSF του κĮρβοξυτελικού άκρου C σε ĮποδιĮτĮκτικές κĮι μη συνθήκες με υψηλή κĮι χĮμηλή συγκέντρωση άλĮτος κĮι pH 9.0. Οι κορυφές των κĮμπυλών Įντιπροσωπεύουν τη θερμοκρĮσίĮ τήξης της πρωτεΐνης

3.2 ΔημιουργίĮ κĮι Įπομόνωση συμπλόκου μετĮξύ των τμημάτων 6ΧHis-Ν2 κĮι 6Xhis-C

Εφόσον βρέθηκĮν οι συνθήκες Įπομόνωσης κĮι κĮθĮρισμού των πρωτεϊνών, πρĮγμĮτοποιήθηκε πείρĮμĮ in vitro γιĮ το σχημĮτισμό συμπλόκου Ν-C. ΤĮ δύο πρωτεΐνικά τμήμĮτĮ της HURP, N2 κĮι C, ĮφέθηκĮν νĮ Įντιδράσουν μετĮξύ τους γιĮ 3h σε θερμοκρĮσίĮ δωμĮτίου υπο ĮνĮστροφή. Στη συνέχειĮ το σύμπλοκο Įπομονώθηκε με τη χρηση χρωμĮτογρĮφίĮς διήθησης (SEC) ( διĮγρĮμμĮ 3.10, εικόνĮ 3.16).

ΕπιλέχθηκĮν τĮ εκλούσμĮτĮ 8-11 (εικόνĮ 3.16) κĮθότι εκλούοντĮι στο σωστό ογκο βάση πειρĮμάτων τιτλοδότησης γιĮ τη κολώνĮ SEC η οποίĮ είχε ήδη προηγηθεί.

Το έκλουσμĮ 12 που φένετĮι νĮ περιέχει ισομοριĮκές ποσότητες των δύο τμημάτων εκλούετĮι σε όγκο που Įντιστοιχεί σε μοριĮκό βάρος μικρότερο του ĮνĮμενόμενου. ΠιθĮνά Įφορά μονομερή των τμημάτων τĮ οποίĮ εκλούοντĮι τĮυτόχρονĮ Įλλά δεν Įλληλεπισδρουν μετĮξύ τους γιĮ το σχημĮτισμό συμπλόκου.

ΤĮ εκλούσμĮτĮ 18-23 κĮι 37-40 ηλεκτροφορήθηκĮν ĮλλĮ οι λωρίδες ήτĮν κενές ( τĮ δεδομένĮ δεν δείχνοντĮι)

Abbildung in dieser Leseprobe nicht enthalten

ΔιάγρĮμμĮ 3.10. Υγρή ΧρωμĮτογρĮφίĮ διήθησης του συμπλόκου 6XHis/C-6XHis/N2 σε διάλυμĮ πĮνĮδιάλυσης κĮι σε pH 7.5.

Abbildung in dieser Leseprobe nicht enthalten

3.3 Μελȑτη πρωτεϊνικών Įλληλεπιδράσεων των τμημάτων Ν2, C κĮι του συμπλόκου Ν& C με μιτωτικά εκχυλίσμĮτĮ HeLa κυττάρων με πείρĮμĮ κĮθίζησης (6XHis-tag pull down)

ΒιβλιογρĮφικά είνĮι γνωστό ότι το κĮρβοξυ-τελικό τμήμĮ της HURP (- C) ελέγχει την ικĮνότητĮ πρόσδεσης της πρωτεΐνης στους μικροσωληνίσκους, μέσω πρόσδεσης/Įπελευθέρωσης του Įμινο-τελικού τμήμĮτος Ν, που περιλĮμβάνει την επικράτειĮ πρόσδεσης στους μικροσωληνίσκους. Πιο συγκεκριμένĮ, ότĮν το κĮρβοξυ-τελικό τμήμĮ της HURP βρίσκετĮι σε Įποφωσφορυλιωμένη κĮτάστĮση τότε προσδένετĮι στο Įμινο-τελικό τμήμĮ της HURP, ĮνĮστέλοντĮς την πρόσδεσή του στους μικροσωληνίσκους. ΑντίθετĮ, ότĮν το κĮρβοξυ-τελικό τμήμĮ της HURP φωσφορυλιώνετĮι Įπό την μιτωτική κινάση Aurora A, το Įμινο-τελικό τμήμĮ της είνĮι ελεύθερο νĮ προσδεθεί στους μικροσωληνίσκους κĮι νĮ προκĮλέσει την στĮθεροποίησή κĮι δεσμοποίηση τους. Επομένως, η φωσφορυλίωση ĮνĮιρεί μίĮ ĮνĮστĮλτική ενδομοριĮκή/διĮμοριĮκή ĮλληλεπίδρĮση της HURP (Wong et al., 2008).

χρησιμοποιήθηκĮν γιĮ νĮ κĮτĮκρημνίσουν άλλες πρωτεΐνες Įπό μιτωτικά εκχυλίσμĮτĮ κυττάρων HeLa. Dzτσι έγινε προσπάθειĮ νĮ ĮνĮγνωριστούν άλλες πρωτεΐνες με τις οποίες ίσως Įλληλεπιδρούν τĮ τμήμĮτĮ Įυτά. Τυχό Įλληλέπιδράσεις θĮ χĮρτογρĮφούντĮν είδικĮ στο Įμινο - κĮι κĮρβόξυ-τελικό τμήμĮ της HURP ή θĮ σχετίζοντĮν με τη μετĮξύ τους ενδομοριĮκή ĮλληλεπίδρĮση.

Dzτσι, τĮ πειράμĮτĮ κĮθίζησης με το σύμπλοκο-δόλωμĮ N-C

χρησιμοποιήθηκĮν γιĮ νĮ κĮτĮκρημνίσουν άλλες πρωτεΐνες Įπό μιτωτικά εκχυλίσμĮτĮ κυττάρων HeLa. Dzτσι έγινε προσπάθειĮ νĮ ĮνĮγνωριστούν άλλες πρωτεΐνες με τις οποίες ίσως Įλληλεπιδρά το σύμπλοκο. Τυχόν Įλληλέπιδράσεις θĮ σχετίζοντĮν με την ενδομοριĮκή ĮλληλεπίδρĮση των άμινο-τελικών κĮι κĮρβόξυ-τελικών τμημάτων.

ΧρησιμοποιήθηκĮν Μιτωτικά ΕκχυλίσμĮτĮ κυττάρων HeLa κĮθώς Įυτά είνĮι εμπλουτισμένĮ με τη πρωτεΐνη HURP κĮι με πρωτεΐνες που έχει δειχθεί σε εκχυλίσμĮτĮ Įυγών Xenopus οτι η HURP Įλληλεπιδρά. ΤĮ μιτωτικά εκχυλίσμĮτĮ έχουν δεχθεί μετĮφρĮστικές τροποποιήσεις οι οποίες είνĮι ĮπĮρĮίτητες γιĮ τη πρĮγμĮτοποίηση των Įλληλεπιδράσεων. ΘĮ περιμένĮμε νĮ δούμε την πρόσδεση των τμημάτων της HURP με κάποιĮ άλλη πρωτεΐνη ή κĮι την ίδιĮ τη HURP του μιτωτικού εκχυλίσμĮτος. Η πρόσδεση στη ριτίνη ήτĮν ικĮνοποιητική κĮθώς δεν εκλούστηκε μεγάλη ποσότητĮ μη προσδεδεμένης πρωτεΐνης (εικονĮ 3.17)

Δυστυχώς, η ĮνĮγνώριση πρωτεϊνών που Įλληλεπιδρούν με την HURP δεν κĮτεστή δυνĮτή λόγω υψηλού θορύβου (εικόνĮ 3.18). Σε επĮνάληψη του πειράμĮτος θĮ πρέπει νĮ ĮπομĮκρυνθεί η πρόσδεση μη ειδικών πρωτεϊνών στη ρητίνη, χρησιμοποιώντĮς διάλυμĮ υψηλότερης ĮλĮτότητĮς. Επίσης, ίσως ο χρόνος επώĮσης των ĮνĮσυνδυĮσμένων πρωτεϊνών με τĮ κυττĮρικά εκχυλίσμĮτĮ δεν επĮρκεί γιĮ τη δημιουργίĮ κάποιου συμπλόκου.

Αντιδράσεις ΑλληλεπίδρĮσης

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.17 SDS-PAGE Įνάλυση των εκλουσμάτων που Įποτελούν τις μή προσδεδεμένες πρωτεΐνες των Įντιδράσεων 1-7. Η πρόσδεση επιτεύχθει σε ικĮνοποιητικό βĮθμό.

Abbildung in dieser Leseprobe nicht enthalten

ΕικονĮ 3.18 SDS-PAGE Įνάλυση των εκλουσμάτω ριτίνης των Įντιδράσεων 1-7. Ο υψηλός βĮθμός θορύβου δεν επιτρέπει την ĮσφĮλή διεξĮγωγή συμπεράσμĮτος

4. ΣΥΖΗΤΗΣΗ

Στόχος της πĮρούσĮς διπλωμĮτικής εργĮσίĮς ήτĮν νĮ μελετηθούν οι ενδομοριĮκές/διĮμοριĮκές Įλληλεπιδράσεις της πρωτεΐνης HURP κĮι συγκεκριμένĮ Įυτές των πρωτεΐνικών τμημάτων C.

ΒιβλιογρĮφικά είνĮι γνωστό ότι το κĮρβοξυ-τελικό τμήμĮ της HURP ελέγχει την ικĮνότητĮ πρόσδεσης της πρωτεΐνης στους μικροσωληνίσκους, μέσω ελέγχου του Įμινο-τελικού τμήμĮτός της, που περιλĮμβάνει την επικράτειĮ πρόσδεσης στους μικροσωληνίσκους. ΕιδικότερĮ, ότĮν το κĮρβοξυ-τελικό τμήμĮ της HURP βρίσκετĮι σε Įποφωσφορυλιωμένη μορφή τότε προσδένετĮι στο Įμινο-τελικό τμήμĮ της HURP, ĮνĮστέλοντĮς την πρόσδεσή του στους μικροσωληνίσκους. ΑντίθετĮ, ότĮν το κĮρβοξυ-τελικό τμήμĮ της HURP φωσφορυλιώνετĮι Įπό την μιτωτική κινάση Aurora A, το Įμινο-τελικό τμήμĮ της είνĮι ελεύθερο νĮ προσδεθεί στους μικροσωληνίσκους κĮι νĮ προκĮλέσει την στĮθεροποίησή τους. Επομένως, η φωσφορυλίωση ĮνĮιρεί μίĮ ĮνĮστĮλτική ενδομοριĮκή/διĮμοριĮκή ĮλληλεπίδρĮση της HURP (Wong et al., 2008).

Με in vitro δοκιμές διĮπιστώσĮμε την δημιουργίĮ συμπλόκου μετĮξύ του Įμινο-τελικού κĮι του κĮρβοξυτελικού τμήμĮτος της πρωτεΐνης HURP. Σε εξέλιξη βρίσκοντĮι πειράμĮτĮ θερμιδομετρίĮς ισοθερμικής τιτλοποίησης (Isothermal Titration Calorimetry- ITC) κĮι ĮνĮλυτικής υπερφυγοκέντρησης (Analytical UltraCentrifugation-AUC) με σκοπό νĮ κĮθορίσουμε την κινητική που χĮρĮκτηρίζει την μετĮξύ τους πρόσδεση, την στοιχειομετρίĮ ĮλληλεπίδρĮσης κĮθώς κĮι τον τρόπο που επηρεάζει η φωσφορυλίωση του κĮρβοξυτελικού τμήμĮτος την μετĮξύ τους πρόσδεση.

Με το ITC, σε ένĮ μονĮδικο πείρĮμĮ προσδιορίζοντĮι τĮυτόχρονĮ όλες οι περάμετροι που Įφορούν τη πρόσδεση πρωτεΐνων κĮθώς Įυτές σχημĮτίζουν σύμπλοκĮ. Οι πĮράμετροι είνĮι: η στοιχειομετρίĮ της ĮντίδρĮσης με μέτρηση των molar (n), η στĮθερά πρόσδεσης (Κ), η μετĮβολή της ενθĮλπίĮς (ΔΗ) κĮι η μετĮβολή της εντροπίĮς (ΔS). ΠρόκειτĮι γιĮ μιĮ θερμοδυνĮμική τεχνική που μετρά ĮπευθείĮς τη θερμότητĮ που εκλύετĮι ή ĮπορροφάτĮι κĮτĮ την ĮλληλεπίδρĮση των μορίων κĮι μπορεί νĮ προσδιορίσει όλες τις πĮρĮπάνω πĮρĮμέτρους πĮρέχοντĮς ένĮ πλήρες θερμοδυνĮμικό προφίλ των Įλληλεπιδράσεων, κĮθιστώντĮς εύκολο τον προσδιορισμό της συγγένειĮς μετĮξύ των μορίων κĮι το μηχĮνισμό ĮλληλεπίδρĮσης τους.

Με τη μέθοδο της ĮνĮλυτικής υπερφυγοκέντρησης (AUC) μπορεί νĮ υπολογιστει το μοριĮκό βάρος μεγάλων πρωτεΐνων ή πρωτεΐνικών συμπλόκων, η στοιχειομετρίĮ των Įντιδράσεων, η τάση γιĮ δημιουργίĮ ομοπολυμερών (aggregations) , το πρωτεΐνικό μέγεθος κĮι σχήμĮ κĮι τη διĮπίστωση δημιουργίĮς πρωτεΐνικών συμπλόκων. Οι πληροφορίες ĮντλούντĮι Įπο το ρυθμό μετĮκίνησης των μορίων, δηλĮδή τη τĮχύτητĮ κĮθίζησης τους η οποίĮ εξĮρτάτĮι άμεσĮ Įπο το μοριĮκό βάρος των μορίων. ΤĮ δεδομενĮ που πρόκειτĮι νĮ Įντληθούν Įπο τις πĮρĮπάνω πειρĮμĮτικές διĮδικĮσίες ĮνĮμένετĮι νĮ επικυρώσουν την ĮλληλεπίδρĮση που βλέπουμε μετĮξύ των τμημάτων N κĮι C κĮι νĮ ĮποδιĮσĮφηνίσουν τη φύση της ĮλληλεπίδρĮσης τους.

Πρώτη Įνάγκη ωστόσο γιĮ τη πĮρούσĮ εργĮσίĮ ήτĮν ο κĮθĮρισμός των πρωτεΐνών που προκύπτουν Įπο κλωνοποίηση των ĮνĮσυνδυĮσμένων πλĮσμιδίων pET28a/N2 κĮι pT7-7/ C. Οι συγκέκριμένοι κλώνοι επιλέχθηκĮν εφόσον κωδικοποιούν μιĮ μικρή ĮλληλουχίĮ-ετικέτĮ, την 6XHis-tag κĮι οι πρωτεϊνες που κωδικοποιούν εκφράζοντĮι πολύ ικĮνοποιητικά γεγονός που οφείλετĮι στο οτι οι συγκεκριμένοι κλώνοι των τμημάτων της HURP Įντιστοιχούν σε κĮτάλληλες δομικές επικράτειες οι οποίες επιτρέπουν τη σωστή ĮνĮδίπλωση των τμημάτων Įυτών κĮι άρĮ ενισχύουν τη στĮθερότητĮ τους.

Ν2 Įμινοτελικό τμήμĮ

Η έκφρĮση του Įμινοτελικού τμήμĮτος Ν2 βρέθηκε νĮ βελτιστοποιείτĮι με επĮγωγή με 0.5mM IPTG στους 25οC γιĮ 3.5h υπο ζωηρή Įνάδευση (200rpm).

Ο βĮθμός κĮθĮρότητĮς του Įμινοτελικού τμήμĮτος Ν2 όπως προκύπτει Įπο το κĮθĮρισμό σε στήλη μετĮλλικής συγγένειĮς Ni-NTA με την εκμετάλλευση του 6XHis-tag που φέρει, υπο μή ĮποδιĮτĮκτικές συνθήκες ,είνĮι Įρκετά ικĮνοποιητικός.

Προσπάθειες γιĮ περετĮίρω κĮθĮρισμό με τη χρήση υγρής χρωμĮτογρĮφίĮς κĮτιοντοĮντĮλλĮγής ήτĮν Įνεπιτυχείς. Το ισοηλεκτρικό σημείο της πρωτεΐνης είνĮι 11.02 (πίνĮκĮς 3.2) κĮι το pH του διĮλύμĮτος είνĮι 7.5 . Επομένως η πρωτεΐνη θĮ έπρεπε νĮ είνĮι Įρκετά θετικά φορτισμένη κĮι νĮ μπορεί νĮ προσδεθεί σε στήλη κĮτιοντοĮντĮλλĮγής. Δυστυχώς, δεν είδĮμε κάτι τέτοιο. Η μείωση του pH σε τιμές 6.0-6.5 οδήγησε στη κĮτĮκρίμνηση της πρωτεΐνης. ΣημĮντικός πĮράγοντĮς είνĮι βέβĮιĮ κĮι η ĮλĮτότητĮ του διĮλύμĮτος. Η πρόσδεση στη στήλη κĮτιοντοĮντĮλλĮγής μπορεί νĮ πĮρεμποδίζετĮι λόγω της υψηλής ĮλĮτότητĮς στο διάλυμĮ επĮνĮδιάλυσης του τμήμĮτος N2 ( 437mM NaCl) .ΠρĮγμĮτοποιήθηκε μιĮ δοκιμή με μείωση της ĮλĮτότητĮς του διĮλύμĮτος επĮνĮδιάλυσης του τμήμĮτος Ν2 στĮ 150mM Įλλά κĮι πάλι η πρόσδεση δεν ήτĮν δυνĮτή. ΠιθĮνά περĮιτέρω μείωση νĮ είνĮι ωφέλιμη, ĮλλĮ διĮκινδυνεύετĮι η στĮθερότητĮ της πρωτεΐνης. Μελλοντικά, μπορεί νĮ δοκιμĮστεί η ĮλλĮγή διĮλύμĮτος επĮνĮδιάλυσης της πρωτεΐνης με χĮμηλή συγκέντρωση άλĮτος (50-100mM) κĮι pH 7.5 κĮι Įφού ελεγχθεί η στĮθερότητĮ του Ν2 τμήμĮτος σε Įυτό, νĮ δοκιμĮστεί η πρόσδεση του σε στήλη κĮτιοντοĮντĮλλĮγής.

ΚĮρβοξυτελικό τμήμĮ C

Η έκφρĮση του κĮρβόξυτελικού τμήμĮτος C βελτιστοποιείτĮι με επĮγωγή με τη προσθήκη 1mM IPTG γιĮ 3.5h στους 25οC υπο ζωηρή Įνάδευση (200rpm) .Δοκιμάστηκε κĮι η επĮγωγή με τη προσθήκη 1mM IPTG γιĮ 2h στους 37οC υπο ζωηρή Įνάδευση (200rpm) γιĮ την ενίσχυση σχημĮτισμού έγκλειστων σωμĮτίων ĮλλĮ δεν υπήρψε διĮφορά στην εκφρĮζόμενη πρωτεΐνη.

ΓιĮ την Įπομόνωση της Įπο το κυττĮρικό ίζημĮ χρησιμοποιήθηκε το Įντίστοιχο προτόκολλο εφόσον η πρωτεΐνη φĮίνετĮι νĮ σχημĮτίζει έγκλειστĮ σωμάτιĮ (inclution bodies). O κĮθĮρισμός της έγινε με την εκμετάλλευση του 6XHis-tag που φέρει, σε στήλη μετĮλλικής συγγένειĮς Ni-NTA , σε σύστημĮ FPLC . Η πρόσδεση της πρωτεΐνης στη στήλη κĮι η πλύση της γιĮ την έκλουση μη είδικά προσδεδεμένων μορίων έγινε σε ĮποδιĮτĮκτικές συνθήκες πĮρουσίĮ 6Μ ουρίĮς . Ακολούθησε Įπομάκρυνση της ουρίĮς ενόσο η πρωτεΐνη ήτĮν προσδεδεμένη στη στήλη κĮι τέλος, έγινε έκλουση με κλίση συγκέντρωσης ιμιδĮζολίου.

Δοκιμάστηκε η εκλουση με ιμιδĮζόλιο σε ĮποδιĮτĮκτικές συνθήκες πĮρουσίĮ ουρίĮς Įλλά η κĮθĮρότητĮ της πρωτεΐνης δεν ήτĮν εξίσου ικĮνοποιητική. Στη περίπτωση Įυτή η επĮνĮδιάτĮξη της πρωτεΐνης έγινε με στĮδιĮκή Įπομάκρυνση της ουρίĮς με διĮπίδυση (step Dialysis) Σε μιĮ προσπάθειĮ επίτευξης της μέγιστης δυνĮτής κĮθĮρότητĮς του κĮρβοξυτελικού τμήμĮτος C, χρησιμοποιήθηκε υγρή χρωμĮτογρĮφίĮ ĮνιοντοĮντĮλλĮγής. Το ισοηλεκτρικό σημείο της πρωτεΐνης είνĮι 4.98 (πίνĮκĮς 3.3) κĮι το pH του διĮλύμĮτος είνĮι 7.5 . Επομένως η πρωτεΐνη θĮ έπρεπε νĮ είνĮι Įρκετά Įρνητικά φορτισμένη κĮι νĮ μπορεί νĮ προσδεθεί σε στήλη ĮνιοντοĮντĮλλĮγής. Δυστυχώς, δεν είδĮμε κάτι τέτοιο. Dzγινε σάρωση DSF γιĮ τη διĮπίστωση της στĮθερότητĮς του κĮρβοξυτελικού τμήμĮτος σε διάλυμĮ χĮμηλής ĮλĮτότητĮς (43.7mM ΝaCl) κĮι υψηλότερου pH (9.0) τόσο σε ĮποδιĮτĮκτικές όσο κĮι σε μη ĮποδιĮτĮκτικές συνθήκες. ΤĮ ĮποτελέσμĮτĮ ήτĮν ενθĮρρυντικά κĮι υπο ĮποδιĮτĮκτικές συνθήκες σημειώθηκε μερική πρόσδεση στη στήλη ĮνιοντοĮντĮλλĮγής. Ωστόσο ĮνάμεσĮ στĮ εκλούσμĮτĮ δεν υπήρχε κάποιο κλάσμĮ με κĮθĮρότερη πρωτεΐνη Įπο Įυτή που εισάχθηκε στη στήλη.

Συμπλοκο Įμινοτελικού τμήμĮτος Ν2-κĮρβοξυτελικού τμήμĮτος C

Αν κĮι δεν επετεύχθει ο βέλτιστος δυνĮτός κĮθĮρισμός των τμημάτων Ν2 κĮι C, οι δύο πρωτεΐνες έχουν ένĮ ικĮνοποιητικό ποσοστό κĮθĮρότητĮς 80% . Επομένως ήτĮν δυνĮτή η χρήση τους σε ĮντίδρĮση ĮλληλεπίδρĮσης γιĮ το σχημĮτισμό συμπλόκου μετĮξύ τους. Η ĮντίδρĮση ήτĮν επιτυχής κĮι το σύμπλοκο έγινε εμφĮνές κĮι Įπομονώθηκε με τη χρήση Υγρής ΧρωμĮτογρĮφίĮς μοριĮκής διήθησης (SEC).

ΠειράμĮ κĮθίζησης Πρωτεϊνών σε Μιτωτικά ΕκχυλίσμĮτĮ HeLa Κυττάρων

Μετά την Įπομόνωση του συμπλόκου επιχειρήθηκε ο χĮρĮκτηρισμός της λειτουργίĮς του με in vitro πείρĮμĮ κĮθίζησης πρωτεϊνών σε μιτωτικά εκχυλίσμĮτĮ HeLa κυττάρων. ΤĮ εκχυλίσμĮτĮ ĮφέθηκĮν νĮ Įντιδράσουν με το τμήμĮ Ν2,το τμήμĮ C κĮι το σύμπλοκο Ν2-C, ξεχωριστά. Στη συνέχειĮ έγινε πρόσδεση τους σε ριτίνη μετĮλλικής συγγένειĮς Ni-NTA. ΑκολούθησĮν εκτενείς πλύσης κĮι τέλος οι προσδεδεμένες στη ριτίνη πρωτεΐνες ηλεκτροφορήκĮν σε πηκτή πολυĮκρυλĮμίδης. Δυστυχώς λόγω του υψηλού θορύβου Įπo τη μη ειδική πρόσδεση των εκχυλισμάτων δεν είνĮι ξεκάθĮρο Įν κάποιες ζώνες εμφĮνίζοντĮι, χάνοντĮι ή Įλλάζουν Įν κĮι υπάρχει κάποιĮ υποψίĮ ĮλληλεπίδρĮσης. Μελλοντικά γιĮ τη βĮλτίωση των συνθηκών του πειράμĮτος μπορεί νĮ τροποποιηθεί το πρωτόκολλο ωστε νĮ γίνετĮι:

1.

2. ΕπώĮση των εκχυλισμάτων με τη ριτίνη γιĮ νĮ προσδεθούν οι μη ειδικά προσδεδεμένες πρωτεΐνες
3. Απομάκρυνση της ριτίνης.
4. ΕπώĮση του κλάσμĮτος των εκχυλισμάτων που δεν προσδέθηκε στη ριτήνη με τις πρωτεΐνες- δολώμĮτĮ που φέρουν την ĮλληλουχίĮ ετικέτĮ 6XΗis.
5. Προσδεσή τους σε νέĮ ριτίνη Ni-NTA
6. Εκτενή ΠλυσίμĮτĮ.
7. Ηλεκτροφόρηση SDS-PAGE της ριτίνης.

Άλλες ρυθμίσεις / τροποποιήσεις μπορεί νĮ Įφορούν την Įύξηση του χρόνου ĮλληλεπίδρĮσης των εκχυλισμάτων με τις πρωτεΐνες, την Įύξηση του χρόνου πρόσδεσης τους στη ριτίνη ή κĮι την πλύση της ριτίνης με διάλυμĮ με Įυξημένη ĮλĮτότητĮ.

Σε περίπτωση που το πείρĮμĮ ήτĮν επιτυχές, θĮ Įκολουθούσε

ĮνοσοĮποτύπωση κĮτĮ Western με τη χρήση Įντισωμάτων κĮτĮ των υποψήφιων πρωτεϊνών που συμμετέχουν στο σύμπλοκο.

ΣύμφωνĮ με τĮ μέχρι σήμερĮ ευρήμĮτĮ γιĮ την HURP σε εκχυλίσμĮτĮ Įυγών βĮτράχου X.laevis, η HURP συμμετέχει σε σύμπλοκο με τις Aurora A, XMAP215, Eg5 κĮι TPX2. Υποθέτουμε πως ίσως το ίδιο σύμπλοκο σχημĮτίζετĮι κĮι στον άνθρωπο, Įφού έχουν ĮνĮγνωριστεί οι ομόλογες τους πρωτεΐνες. ΑνĮφέροντĮι τĮ μοριĮκά βάρη των ομόλογων Įυτών πρωτεϊνών στον άνθρωπο γιĮ τη διευκόλυνση της εξĮγωγής συμπερĮσμάτων.

- Η Aurora A (~AURKA) έχει μοριĮκό βάρος ~45KDa,
- Η ΧΜΑΡ215 (~ch-TOG) ~225KDA,
- Η Eg5 (~Kif11) 119KDa
- Η ΤΡΧ2 ~85KDa.

ΠεριμένĮμε νĮ δούμε κĮι τη κĮθίζηση της ίδιĮς της HURP . Το Įμινοτελικό άκρο έχει υποδείξει υψηλή τĮσή δημιουργίĮς ομοπολυμερών συσσωμάτων (aggregations) ĮπουσίĮ μικροσωληνίσκων στους οποίους προσδένετĮι φυσιολογικά in vivo, ρυθμίζοντĮς τη δεσμοποίηση κĮι στĮθεροποίηση τους. ΣτĮ κυττĮτικά εκχυλίσμĮτĮ δεν υπάρχει ο κυττĮροσκελετός κĮι άρĮ ούτε κĮι οι μικροσωληνίσκοι .Dzτσι κĮθώς το κĮρβόξυ-τελικό άκρο φωσφορυλιώνετĮι Įπο τη μιτωτική κινάση Aurora A κĮι Įπελευθερώνει το Įμινοτελικό άκρο N , μη έχοντĮς που νĮ δεσμευτεί , περιμένĮμε νĮ σχημĮτίσει συσσωμĮτώμĮτĮ με άλλĮ Ν τμήμĮτĮ της HURP , κĮτĮκριμνίζοντĮς τη κĮι κάνοντĮς τη ορĮτή στη πηκτή.

ΘέλĮμε νĮ πρĮγμĮτοποιήσουμε την κĮτĮκρίμνηση πρωτεΐνων σε μιτωτικά κυττĮρικά εκχυλίσμĮτĮ HeLa με πρωτεΐνη-δόλωμĮ την κινάση Aurora A , τόσο την Įγρίου τύπου όσο κĮι τη μεττĮλĮγμένη , εκφρĮσμένες έτσι ώστε νĮ φέρουν 6XHis-tag. Ωστόσο λόγω έλειψης χρόνου τĮ πειράμĮτĮ δεν ολοκληρώθηκĮν.

H Aurora A mutant (K193/R) διĮφέρει Įπο την κινάση σερίνης/ θρεονίνης Aurora A λόγω της μετĮτροπής μιĮ συντηρημένης λυσίνης στην κĮτĮλυτική επικράτειĮ της σε Įργινίνη. Η μετĮτροπή Įυτή κĮθιστά την Aurora A-mutant μόνιμĮ Įνενεργή κĮι ĮνίκĮνη νĮ φωφορυλιώσει τĮ υποστρώμĮτĮ της. ΓνωρίζοντĮς οτι η κινάση Aurora A σχημĮτίζει σύμπλοκο με τη HURP, φωσφορυλιώνοντĮς το κĮρβόξυτελικό άκρο της , κĮι με τη χρήση της Aurora A-mutant ως θετικό έλεγχο μπορούν νĮ Įνιχνευθεί Įν το σύμπλοκο σχημĮτίζετĮι ĮνĮξĮρτήτου ικĮνότητĮς φωσφορυλίωσης της κινάσης κĮι Įν τροποποειτĮί το πρότυπο του συμπλοκου με την ĮπώλειĮ λειτουργείĮς της κινάσης.

5. ΒιβλιογρĮφίĮ

1B.Alberts, D. Bray, A. Johnson, J. Lewis, M. Raff, K. Roberts, P. Walter, Essencial Cell Biology (1998), Garland Publishing, Inc., New York & London
2B. Lewin, GENES VIII (2004), Parson Education.
3ΒĮσίλης ΜĮρμάρĮς, ΜĮρίĮ ΛĮμπροπούλου-ΜĮρμάρĮ, ΒιολογȓĮ Κυττάρου ΜοριĮκη Προσέγγιση (2005), Εκδόσεις Typorama.
4Maiwen Caudron, Gertrude Bunt, Philippe Bastiaens, Eric Karsenti, Spatial Coordination of Spindle Assembly by Chromosome-Mediated Signalling Gradients (2005), Science, Vol.309, No.5739, 1373- 1376.
5Kalab P., Weis K., Heald R., Visualization of a Ran-GTP gradient in interphase and mitotic Xenopus egg extracts (2002), Science, Vol.295, No.5564, 2452-2456.
6Arnaoutov A., Dasso M., The Ran GTPase regulates kinetochore function (2003), Dev. Cell, Vol.5, 99- 111.
7Herman H.W. Sillje, Susanna Nagel, Roman Körner, Erich A. Nigg, HURP Is a Ran Imporin β- Regulated Protein that Stabilizes Kinetochore in the Vicinity of Chromosomes (2006), Current Biology 16, 731-742.
8M. D. Koffa, C. M. Casanova, R. Santarella, T. Kocher, M. Wilm, I. W. Mattaj, HURP Is a
Part of a Ran- Dependent Complex Involved in Spindle Formation (2006), Current Biology 16, 743-754.
9Jung-Mao Hsu, Yuan-Chii G. Lee, Chang-Tze R. Yu, Chi-Ying F. Huang, Fbx7 Functions in the SCF Complex Regulating Cdk1-Cyclin B-phosphorylated Hepatoma Up-regulated Protein (HURP) Proteolysis by a Proline-rich Region (2004), The Journal of Biological Chemistry, Vol.279, No.31, 32592-32602.
10Ann-Ping Tsou, Chu-Wen Yang, Chi-Ying F Huang, Ricky Chang-Tze Yu, Yuan-Chii G Lee, Cha-Wei Chang, Bo-Rue Chen, Yu-Fang Chung, Ming-Ji Fann, Chin-Wen Chi, Jen-Hwey Chiu and Chen-Kung Chou, Identification of a novel cell cycle regulated gene, HURP, overexpressed in human hepatocellular carcinoma (2003), Oncogene 22, 298-307.
11Jim Wong, Robert Lerrigo, Chang-Young Jang, Guowei Fang, Aurora A Regulates the Activity of HURP by Controlling the Accessibility of Its Microtubule-binding Domain (2008), Molecular Biology of the Cell, Vol.19, 2083-2091.
12Rachel A. Santarella, Maria D. Koffa, Peter Tittmann, Heinz Gross, Andreas Hoenger, HURP Wraps Microtubule Ends with an Additional Tubulin Sheet That Has a Novel Conformation of Tubulin (2007), Journal of Molecular Biology 365, 1587-1595.
13Trisha N. Davis, Linda Wondermann, Rings, bracelets, sleeves, and chevrons: new structures of kinetochore proteins (2007), TRENDS in Cell Biology, Vol.17, No.8, 376-382.
14Tomotoshi Marumoto, Dongwei Zhang,Hideyuki Saya, Aurora A-A Guardian of Poles (2005), Nature Reviews, Vol.5.
15Régis Giet, Clotilde Petretti, Claude Prigent, Aurora kinases, aneuploidy and cancer, a coincidence or a real link? (2005), TRENDS in Cell Biology, Vol.15, No.5.
16Nicholas Keen, Stephen Taylor, Aurora-Kinase Inhibitors as Anticancer Agents (2004), Nature Reviews, Vol.4.
17Lim Shen Kiat, Kam Man Hui, Ganesan Gopalan, Aurora-A Kinase Interacting Protein (AIP), a Novel Negative Regulator of Human Aurora-A Kinase (2002), The Journal of Biological Chemistry, Vol.277, No.47, 45558-45565.
18Shen Kiat Lim, Ganesan Gopalan, Aurora-A kinase interacting protein 1 (AURKAIP1) promotes Aurora-A degradation through an alternative ubiquitin-independent pathway (2007), Biochemical Journal, Vol.403, 119-127.
19Kelly Anderson, Jingsong Yang, Kristin Koretke, Kelvin Nurse, Amy Calamari, Robert B. Kirkpatrick, Denis Patrick, Domingos Silva, Peter J. Tummino, Robert A. Copeland, Zhihong Lai, Binding of TPX2 to Aurora A Alters Substrate and Inhibitor Interactions (2007), Biochemistry 46, 10287-10295.
20Thomas A. Kufer, Herman H.W. Sillje, Roman Korner, Oliver J. Gruss, Patrick Meraldi, Erich A. Nigg, Human TPX2 is required for targeting Aurora-A kinase to the spindle (2002), The Journal of Cell Biology, Vol.158, No.4, 617-623.
21Frank Eckerdt, Patrick A. Eyers, Andrea L. Lewellyn, Claude Prigent, James L. Maller, Spindle Pole Regulation by a Discrete Eg5-Interacting Domain in TPX2 (2008), Current Biology 18, 519-525.
22 Gruss O. J., Wittmann M., Yokoyama H., Pepperkok R., Kufer T., Sillje H., Karsenti E., Mattaj I. W., Vernos I., Chromosome-induced microtubule assembly mediated by TPX2 is required for spindle formation in HeLa cells (2002), Nat. Cell Biol. 4, 871-879.
23Sarah Garrett, Kristi Auer, Duane A. Compton, Tarun M. Kapoor, hTPX2 Is Required for Normal Spindle Morphology and Centrosome Integrity during Vertebrate Cell Division (2002), Current Biology, Vol.12, 2055-2059.
24Claudia M. Casanova, Sofia Rybina, Hideki Yokoyama, Eric Karsenti, Iain W. Mattaj, Hepatoma Up- Regulated Protein Is Required for Chromatin-induced Microtubule Assembly Independently of TPX2 (2009), Molecular Biology of the Cell, Vol.19, 4900-4908.
25Vasquez R. J., Gard D. L., Cassimeris L., XMAP from Xenopus eggs promote rapid plus end assembly of microtubules and rapid microtubule polymer turnover (1994), J. Cell Biol. 127, 985-993
26Joseph Sambrook, David W.Russel, Molecular Cloning A LABORATORY MANUAL (2001), COLD SPRING HARBOR LABORATORY PRESS, Third edition, New York
27Ching-Yen Tsai, Chen-Kung Chou, Chu-Wen Yang, Yi-Chen Lai, Chih-Chia Liang, ChunMing Chen, Ting-Fen Tsai, Hurp deficiency in mice leads to female infertility caused by an implantation defect. The Journal of Biological Chemistry (2008) Volume: 283, Issue: 39, Pages: 26302-26306
28Frank H Niesen1, Helena Berglund2 & Masoud Vedadi3 The use of differential scanning fluorimetry to detect ligand interactions that promote protein stability Nature Protocols 2, 2212 - 2221 (2007)

Details

Pages
100
Year
2011
ISBN (Book)
9783668190436
File size
4.1 MB
Language
Modern Greek
Catalog Number
v317958
Institution / College
Democritus University Of Thrace – Molecular Biology and Genetics
Grade
A+ or 10.0
Tags
hepatoma regulated protein hurp

Author

  • Eva Ka (Author)

Share

Previous

Title: An in vitro study of the expression, purification and intramolecular interactions of Hepatoma Up Regulated Protein (HURP)